KEGG   Bacillus subtilis subsp. subtilis 168: BSU31370Help
Entry
BSU31370          CDS       T00010                                 

Gene name
yugJ
Definition
(RefSeq) NADH-dependent butanol dehydrogenase 1
  KO
K19955  alcohol dehydrogenase [EC:1.1.1.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU31370 (yugJ)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     BSU31370 (yugJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 2OG-FeII_Oxy_5
Motif
Other DBs
NCBI-GeneID: 937164
NCBI-ProteinID: NP_391015
Pasteur: BG12364
BSORF: BG12364
UniProt: O05239
Position
complement(3223471..3224634)
Genome map
AA seq 387 aa AA seqDB search
MQNFTYWNPTKLIFGRGEVERLPEELKPYGKNVLLVYGGGSIKRSGLYDQVIEQLNKAGA
TVHELAGVEPNPRVSTVNKGVAICKEQNIDFLLAVGGGSVIDCTKAIAAGAKYDGDAWDI
VTKKHQPKDALPFGTVLTLAATGSEMNSGSVITNWETKEKYGWGSPLVFPKFSILDPVNT
FTVPKNHTIYGMVDMMSHVFEQYFHHVSNTPYQDRMCESLLRTVIETAPKLINDLENYEL
RETILYTGTIALNGMLSMGARGDWATHNIEHAVSAVYDIPHAGGLAILFPNWMRHTLSEN
PARMKQLAVRVFDVEEAGKTDEEIALEGIDKLSAFWTSLGAPNRLADYDINDEQLDTIAD
KAMANGTFGQFKSLNKEDVLSILKASL
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaactttacatactggaatccgaccaaattaattttcgggcgcggcgaagtggaa
agacttccggaggaactcaaaccttacggaaaaaacgtattgcttgtgtacggaggcggc
agcattaaacgcagcggcctgtatgatcaagtgattgaacagctgaataaagccggagcg
accgtgcatgaattagcaggtgtggaaccgaatcctcgtgtgtcgactgttaataaaggt
gttgccatctgtaaagaacaaaacattgatttcttgctggctgtcggaggcggaagcgta
atcgactgtacaaaagcgattgccgcaggagcgaagtatgatggtgatgcgtgggatatc
gttacgaaaaagcatcagccaaaagatgctttgccattcggaacggtattgactctcgct
gcaactggttcagaaatgaactcaggatctgttattacaaactgggaaacaaaagaaaaa
tacggctggggcagcccgctcgtattccctaaattctcgattcttgatccggtgaataca
ttcaccgtacctaaaaaccacacgatctacgggatggttgacatgatgagccacgtattc
gaacaatacttccatcatgtatcaaacacgccgtatcaggaccgcatgtgtgaatcactt
ttgcgtacagtcattgaaacagcgcctaagctgatcaatgatctcgaaaattacgaattg
cgtgagacgatcctgtacacaggaacaatcgcattaaacggcatgctttctatgggggca
agaggggattgggctactcataatattgaacatgcagtatcagccgtttatgatattccg
catgccggcggactggcgattctgttcccgaattggatgagacacacattgtctgaaaac
cctgcccgcatgaaacagcttgcagttcgcgtgtttgatgttgaagaagcaggtaaaacg
gatgaagaaattgcccttgaaggtatcgataagctgtccgcattctggacaagtcttggc
gctccgaaccgtcttgctgattatgatattaatgatgagcagcttgacacaatcgctgac
aaggcaatggctaacggtacattcggccaatttaaatcactcaacaaagaagatgtgctg
tcaattttgaaagcatcactataa

DBGET integrated database retrieval system