KEGG   Bacillus subtilis subsp. subtilis 168: BSU31380
Entry
BSU31380          CDS       T00010                                 

Gene name
yuzA
Definition
(RefSeq) hypothetical protein
  KO
K09779  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU31380 (yuzA)
SSDB
Motif
Pfam: DUF378
Other DBs
NCBI-GeneID: 937163
NCBI-ProteinID: NP_391016
Pasteur: BG14050
BSORF: BG14050
UniProt: O32087 A0A6M3ZFR6
Position
3224864..3225100
AA seq 78 aa
MSTIQRICLVLTIIGAINWGLIGFFQFDLVAAIFGGQGSALSRIIYGLVGIAGLINLGLL
FKPNEERSREEAANPEMR
NT seq 237 nt   +upstreamnt  +downstreamnt
atgagtaccattcaaagaatttgtcttgtattaaccatcattggcgccattaactgggga
ctgatcggatttttccaatttgacttagtagcggctatcttcggcggccaagggtcagct
ctttcccgaatcatttacggacttgtcggaatcgccggcttaatcaacctcggtctgcta
tttaagccaaacgaggaaagatcacgtgaagaagcagcaaatcctgaaatgcgatag

DBGET integrated database retrieval system