KEGG   Bacillus subtilis subsp. subtilis 168: BSU31390Help
Entry
BSU31390          CDS       T00010                                 

Gene name
yugI
Definition
(RefSeq) general stress protein 13
  KO
K07570  general stress protein 13
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99974 Translation
    BSU31390 (yugI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S1 S1_2 RNase_II_C_S1 CsrA CTC1_2
Motif
Other DBs
NCBI-GeneID: 938849
NCBI-ProteinID: NP_391017
Pasteur: BG12363
BSORF: BG12363
UniProt: P80870
Structure
PDB: 

Position
complement(3225178..3225570)
Genome map
AA seq 130 aa AA seqDB search
MAAKFEVGSVYTGKVTGLQAYGAFVALDEETQGLVHISEVTHGFVKDINEHLSVGDEVQV
KVLAVDEEKGKISLSIRATQAAPEKKESKPRKPKAAQVSEEASTPQGFNTLKDKLEEWIE
MSNRKDLIKK
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaaaatttgaagtgggcagtgtttacactggtaaagttacaggattacaagcg
tatggtgcgtttgttgcattagatgaagaaactcaaggtttagtacacatttctgaagtg
actcacggtttcgtaaaagatatcaacgagcacctttcagttggcgacgaagtacaagta
aaagtacttgctgttgatgaagaaaaaggcaaaatcagcctttcaattcgtgcgacacaa
gctgcgcctgagaaaaaagaaagcaaaccaagaaaacctaaagctgctcaagtaagcgaa
gaagcttctacaccacaaggtttcaacacattaaaagataagcttgaagagtggatcgaa
atgtccaaccgcaaagaccttatcaaaaaataa

DBGET integrated database retrieval system