KEGG   Bacillus subtilis subsp. subtilis 168: BSU31390
Entry
BSU31390          CDS       T00010                                 

Symbol
yugI
Name
(RefSeq) general stress protein 13
  KO
K07570  general stress protein 13
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99974 Translation
    BSU31390 (yugI)
SSDB
Motif
Pfam: S1 S1_2 CsrA RNase_II_C_S1 CTC1_2
Other DBs
NCBI-GeneID: 938849
NCBI-ProteinID: NP_391017
Pasteur: BG12363
BSORF: BG12363
UniProt: P80870 A0A6M3ZFR2
Structure
PDB: 
2K4K

Position
complement(3225178..3225570)
AA seq 130 aa
MAAKFEVGSVYTGKVTGLQAYGAFVALDEETQGLVHISEVTHGFVKDINEHLSVGDEVQV
KVLAVDEEKGKISLSIRATQAAPEKKESKPRKPKAAQVSEEASTPQGFNTLKDKLEEWIE
MSNRKDLIKK
NT seq 393 nt   +upstreamnt  +downstreamnt
atggcagcaaaatttgaagtgggcagtgtttacactggtaaagttacaggattacaagcg
tatggtgcgtttgttgcattagatgaagaaactcaaggtttagtacacatttctgaagtg
actcacggtttcgtaaaagatatcaacgagcacctttcagttggcgacgaagtacaagta
aaagtacttgctgttgatgaagaaaaaggcaaaatcagcctttcaattcgtgcgacacaa
gctgcgcctgagaaaaaagaaagcaaaccaagaaaacctaaagctgctcaagtaagcgaa
gaagcttctacaccacaaggtttcaacacattaaaagataagcttgaagagtggatcgaa
atgtccaaccgcaaagaccttatcaaaaaataa

DBGET integrated database retrieval system