KEGG   Bacillus subtilis subsp. subtilis 168: BSU31400Help
Entry
BSU31400          CDS       T00010                                 

Gene name
alaT
Definition
(RefSeq) aminotransferase YugH
  KO
K10907  aminotransferase [EC:2.6.1.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bsu01007]
    BSU31400 (alaT)
Enzymes [BR:bsu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-  
     BSU31400 (alaT)
Amino acid related enzymes [BR:bsu01007]
 Aminotransferase (transaminase)
  Class I
   BSU31400 (alaT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP Aminotran_5 Beta_elim_lyase Aminotran_MocR OKR_DC_1 Glyco_hydro_20 SelA
Motif
Other DBs
NCBI-GeneID: 938846
NCBI-ProteinID: NP_391018
Pasteur: BG12362
BSORF: BG12362
UniProt: Q795M6
Position
complement(3225772..3226932)
Genome map
AA seq 386 aa AA seqDB search
MTSYLSDYVQQIKPSGIRKFFDLAATMEGVISLGVGEPDFVTAWNVREASILSLEQGYTS
YTANAGLYSLREEISRYLSNRFDLSYSPDNELIVTVGASQALDIAIRAIVNPGEEVIIPE
PCFVAYDALVSLAGGIPVHVHTTADKGFKATAADFEAAVTEKTKAILICSPSNPTGSVYS
KEELNEIAEFAKKHDVIVLADEIYAELTYDEEFTSIAALPGMKERTVVISGFSKAFAMTG
WRLGFAAAPSLLRDAMLKIHQYAMMCAPAMAQFAALEGLKNGMEDVEKMKKSYRRRRNLF
VESLNEIGLSCHHPGGAFYAFPSIKSMGMSSEQFAEELLTQEKVAVVPGSVFGPSGEGYI
RCSYATSIEQLQEALVRMKRFLHKTT
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgacttcgtatttatcagactatgtacaacaaataaaaccatccggcatccgcaaattc
tttgatttggcggcaacgatggaaggcgtcatttctttaggcgtcggcgagcctgatttt
gttaccgcatggaatgtccgcgaagcaagcattctctctcttgaacaaggatatacgtca
tacacggccaatgcgggtttatactcattgcgggaggaaatcagccgttatttgagcaac
aggtttgaccttagctactcgccagataatgagctgattgtgacagtgggggcaagtcag
gctttggatattgcgatccgcgccattgtgaatccaggtgaggaagtcatcattcctgag
ccgtgttttgttgcgtacgatgcgcttgtttctttggcaggcggtatcccggttcacgtt
catacaacggcagacaaaggatttaaagcaacggctgctgattttgaagcggcagtcact
gaaaaaacaaaggccattctcatctgctcaccatcgaatccgacaggttcggtttattcg
aaggaagagctgaatgagattgctgagtttgccaaaaaacatgatgtcatcgtcttagcc
gacgagatctacgcggagctgacatatgatgaggaatttacaagtatagcggcattaccg
ggaatgaaggaacggacggtagtcatctcaggcttttcaaaagcatttgcaatgacgggc
tggaggctcggttttgccgcggcaccatccttgcttcgggatgccatgcttaaaattcat
cagtatgcgatgatgtgcgcgcccgcaatggcgcagtttgccgcccttgaaggcctgaag
aacggcatggaagacgtagaaaaaatgaaaaaaagctatcgaagaagacggaatctgttt
gtagaatcgctcaatgaaatcggtctcagctgtcatcatccgggcggcgctttctatgct
tttccatctatcaaaagcatgggaatgagttcagaacagtttgccgaggagctactgacg
caggaaaaagtggcagttgttcctggaagtgtgtttggtccgagcggtgagggatatatc
cgttgttcatacgcaacctcgattgaacagcttcaagaagcgttagtcagaatgaaacgc
ttcctgcacaaaacaacataa

DBGET integrated database retrieval system