KEGG   Bacillus subtilis subsp. subtilis 168: BSU31410Help
Entry
BSU31410          CDS       T00010                                 

Gene name
yugG
Definition
(RefSeq) AsnC family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AsnC_trans_reg HTH_24 DUF4600 HTH_AsnC-type TrmB MarR Rrf2 TFIIE_alpha RuvB_C HTH_47 Sigma70_r4 DUF4423 Phage_rep_O
Motif
Other DBs
NCBI-GeneID: 937166
NCBI-ProteinID: NP_391019
Pasteur: BG12361
BSORF: BG12361
UniProt: O05236
Position
complement(3226933..3227433)
Genome map
AA seq 166 aa AA seqDB search
MKLTEKETEILEILDENSRADLETIAKMAGIPVNEVKTIIDKLEKEKVIIDYSAMIDWRK
VDGHEGVTAMIDVKVTPKRGVGFDEVAERIYRFQEVESVYLMSGVYDLSVVIRGNSMSDV
ARFVSDKLSTLDSVVSTTTHFILKKYKHDGKVFETGDDDKRIVVSP
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgacagaaaaagaaacagaaatattagaaattttagacgaaaacagccgcgcc
gatttagaaacaatcgcaaagatggcgggcatccctgtaaatgaagtgaaaacaattatt
gacaaactggagaaagaaaaggttattatcgattattccgctatgattgactggcgaaaa
gtcgacggacatgagggcgttacggccatgattgacgtcaaagtaacgccgaagcggggc
gtcggttttgatgaagtggcggaacggatttaccgattccaagaggttgaatcagtttac
ctgatgtcaggcgtatacgatttgtctgtcgtgattcgcggcaattcgatgtctgacgta
gcgcgttttgtttcggataaactctcaacgcttgattcagttgtatctacgacaacccat
tttatcctgaaaaaatacaagcatgacggcaaagtgtttgaaacaggagacgacgacaaa
agaatcgtggtgtcaccgtaa

DBGET integrated database retrieval system