KEGG   Bacillus subtilis subsp. subtilis 168: BSU31420Help
Entry
BSU31420          CDS       T00010                                 

Gene name
yugF
Definition
(RefSeq) hydrolase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Thioesterase Esterase Peptidase_S9 Abhydrolase_2 Ndr FSH1 Abhydrolase_4 Abhydrolase_5 DUF1057 PGAP1 DUF676 LCAT LIDHydrolase DUF915 DUF900
Motif
Other DBs
NCBI-GeneID: 937169
NCBI-ProteinID: NP_391020
Pasteur: BG12360
BSORF: BG12360
UniProt: O05235
Position
3227581..3228402
Genome map
AA seq 273 aa AA seqDB search
MEAVSPIRRFTVDGVNVYYEHYQNPGRQTLVCVHGFLSSAFSFRKVIPLLRDKYDIIALD
LPPFGQSEKSRTFIYTYQNLAKLVIGILEHLQVKQAVLVGHSMGGQISLSAALQKPELFS
KVVLLCSSGYLKRSHPTIIFGTHIPYFHLYIKRWLSKEGVMKNLLNVVHDKSLIDEEMID
GYGRPFQDEQIFKAMTRFIRHREGDLEPEQLKKMNKPALLIWGEEDRIVPMEIGKRLHAD
LPNSVLYSLGQTGHLVPEERPELISEHIADFIK
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atggaggcggtttcaccaataaggcggtttacggtcgatggagtcaatgtatactacgaa
cattatcaaaatcccggcaggcaaacgctggtctgcgtacacggttttttatcatctgca
ttcagcttcagaaaagtaattcctctccttcgggacaagtacgacatcatcgcgcttgat
ttgcctcctttcggccaatctgaaaaatcaagaacgtttatctatacctatcaaaacctt
gctaagcttgtcattgggattttggagcacttgcaagtgaaacaggctgtgcttgtcggg
cattctatgggcgggcagatatcgctgtctgctgctctccaaaaacctgagcttttttca
aaggttgtgctgctttgcagttcagggtatttaaaacgttcacacccgacgattattttc
gggacccatatcccgtattttcatctttacatcaaacgctggctctcgaaagaaggcgtg
atgaaaaatttattaaatgtggtgcatgacaaatcgctgattgatgaggagatgattgac
ggctatggcagaccgtttcaggacgagcagattttcaaagccatgacaaggtttatccgc
cacagagaaggagatttagaacccgagcaattgaagaaaatgaacaagcctgctctattg
atttggggcgaggaggatcgaattgtcccaatggagatcggtaaacggctgcacgcagat
ttgcctaattccgtgctgtactcacttggccagaccggacatctggtgcctgaagaacgg
cctgaacttatttctgaacacattgctgattttatcaaataa

DBGET integrated database retrieval system