KEGG   Bacillus subtilis subsp. subtilis 168: BSU31430
Entry
BSU31430          CDS       T00010                                 

Gene name
yugE
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF1871 DUF3175
Other DBs
NCBI-GeneID: 938847
NCBI-ProteinID: NP_391021
Pasteur: BG12359
BSORF: BG12359
UniProt: O05234 A0A6M4JMU0
Position
complement(3228431..3228691)
AA seq 86 aa
MEESHAVREMIKIIAKWDPFKYGEEFYETEAVDVVQAVYDENDPDLLAKSIQQIFETSFE
QTLPIASCREVAGQLLFIKNSSSCTP
NT seq 261 nt   +upstreamnt  +downstreamnt
atggaagaaagtcatgcggtcagggaaatgattaagatcattgccaaatgggacccgttt
aaatatggagaagagttttacgaaacggaggctgttgatgtcgtgcaggcagtctatgat
gaaaacgatcccgacttgctggcgaaaagcattcagcaaatatttgaaacttcttttgaa
caaacgctgccgatcgccagctgccgggaagtggctggccagcttttattcattaaaaac
agcagctcctgcacgccttaa

DBGET integrated database retrieval system