KEGG   Bacillus subtilis subsp. subtilis 168: BSU31440Help
Entry
BSU31440          CDS       T00010                                 

Gene name
patB
Definition
(RefSeq) cystathionine beta-lyase
  KO
K14155  cysteine-S-conjugate beta-lyase [EC:4.4.1.13]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00270  Cysteine and methionine metabolism
bsu00450  Selenocompound metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BSU31440 (patB)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BSU31440 (patB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bsu01007]
    BSU31440 (patB)
Enzymes [BR:bsu01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.13  cysteine-S-conjugate beta-lyase
     BSU31440 (patB)
Amino acid related enzymes [BR:bsu01007]
 Aminotransferase (transaminase)
  Class II
   BSU31440 (patB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-GeneID: 937170
NCBI-ProteinID: NP_391022
Pasteur: BG10744
BSORF: BG10744
UniProt: Q08432
Position
3228778..3229941
Genome map
AA seq 387 aa AA seqDB search
MNFDKREERLGTQSVKWDKTGELFGVTDALPMWVADMDFRAPEAITEALKERLDHGIFGY
TTPDQKTKDAVCGWMQNRHGWKVNPESITFSPGVVTALSMAVQAFTEPGDQVVVQPPVYT
PFYHMVEKNGRHILHNPLLEKDGAYAIDFEDLETKLSDPSVTLFILCNPHNPSGRSWSRE
DLLKLGELCLEHGVTVVSDEIHSDLMLYGHKHTPFASLSDDFADISVTCAAPSKTFNIAG
LQASAIIIPDRLKRAKFSASLQRNGLGGLNAFAVTAIEAAYSKGGPWLDELITYIEKNMN
EAEAFLSTELPKVKMMKPDASYLIWLDFSAYGLSDAELQQRMLKKGKVILEPGTKYGPGG
EGFMRLNAGCSLATLQDGLRRIKAALS
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaactttgataaacgagaagaacgccttggcacccaatcggtcaaatgggataaaaca
ggcgaattatttggcgtgacagacgccctcccgatgtgggtggcagatatggattttcgc
gccccggaagcgataactgaagcgttaaaagagcgtcttgaccacggtatttttggttat
acaactccagatcaaaaaacgaaggatgctgtgtgcggatggatgcaaaacaggcacggc
tggaaggtaaatccggaaagcatcacattcagccccggcgttgtaacagctttgagcatg
gcggtacaagcttttacggagccgggcgatcaagtagttgttcagcctccagtttatacg
cctttttaccatatggtggagaaaaacggccggcacattttacataatccgctgctagaa
aaagacggcgcatatgcaatcgattttgaagatttggagacaaagcttagtgacccaagc
gttacattgtttattttatgcaatcctcataacccttctgggcgttcatggagccgggaa
gatttactgaagctaggcgaattgtgccttgagcatggcgtcacagttgtatcggatgaa
atccattccgatttaatgctgtacggacataaacacacgccgttcgcttcgctctctgac
gatttcgctgatatttccgtgacatgtgctgctccaagcaaaacatttaatatcgccgga
ttgcaggcttcagcgatcattattccggatcgcctgaagcgcgccaagttttccgcaagc
cttcagcgaaatggtttaggcggactgaacgcgtttgccgtcactgcaatcgaagccgcg
tattcaaaaggcggaccgtggcttgatgaattgatcacttacattgagaaaaacatgaac
gaagcggaagcctttttgagcaccgagctgccaaaggtcaaaatgatgaagccggatgca
tcatacttgatttggctcgacttcagcgcttacggcttgtccgatgcagagcttcagcaa
agaatgctaaaaaaaggaaaagttattttagagcccgggacgaaatacgggcctggcgga
gaaggatttatgcgcctgaacgccggatgctctcttgcaaccctgcaggacggcctgcgc
cgcatcaaagccgcattatcgtaa

DBGET integrated database retrieval system