KEGG   Bacillus subtilis subsp. subtilis 168: BSU31450Help
Entry
BSU31450          CDS       T00010                                 

Gene name
kinB
Definition
(RefSeq) sporulation kinase B
  KO
K07697  two-component system, sporulation sensor kinase B [EC:2.7.13.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Module
bsu_M00485  KinABCDE-Spo0FA (sporulation control) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU31450 (kinB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bsu01001]
    BSU31450 (kinB)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU31450 (kinB)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     BSU31450 (kinB)
Protein kinases [BR:bsu01001]
 Histidine kinases
  Spo family [OT]
   BSU31450 (kinB)
Two-component system [BR:bsu02022]
 Spo family
  KinABCDE-Spo0FA [MD:M00485]
   BSU31450 (kinB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HATPase_c_3 HATPase_c_5 HATPase_c_2 MukE
Motif
Other DBs
NCBI-GeneID: 937167
NCBI-ProteinID: NP_391023
Pasteur: BG10745
BSORF: BG10745
UniProt: Q08430
Position
3230067..3231353
Genome map
AA seq 428 aa AA seqDB search
MEILKDYLLHICFILFPILLYQVFWLGKPAILVPKINSGLVTLFACGASVLCIIFPIHEM
DYIQYGLQMIPVIICLFYISTASGLTVAASVLCFELLFYEPSAMFVFTLLPFLIIIPILF
QKKWPFMSKAKKLLLSLLISCVEIFLFFASSWILSALNILNFQKSGIFVYEAAVSGLFRS
SVLLLSIYIIESIAENIALRSQLIHSEKMTIVSELAASVAHEVRNPLTVVRGFVQLLFND
ETLQNKSSADYKKLVLSELDRAQGIITNYLDMAKQQLYEKEVFDLSALIKETSSLMVSYA
NYKSVTVEAETEPDLLIYGDATKLKQAVINLMKNSIEAVPHGKGMIHISAKRNGHTIMIN
ITDNGVGMTDHQMQKLGEPYYSLKTNGTGLGLTVTFSIIEHHHGTISFNSSFQKGTTVTI
KLPADLPH
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggaaattctaaaagactatcttctgcacatctgctttattttgtttcctattcttctt
taccaagtgttttggcttggaaaacctgcgattcttgtgccaaaaataaacagcggtttg
gtcacgctcttcgcctgcggcgcctccgttttatgcattattttcccgattcatgaaatg
gactacatacaatacggccttcagatgattcccgttatcatttgtttattttacattagt
accgcttccggacttacagtcgccgcatctgtcctatgttttgaactgcttttttacgaa
ccttccgcaatgtttgttttcactttgctgccttttcttatcattatcccaatcttattt
cagaaaaaatggccattcatgtccaaagcgaaaaaactgctgctgtctttattgatcagc
tgcgtggagattttcctatttttcgcctcaagctggattctttccgccttgaatatttta
aattttcaaaaatcaggaattttcgtttacgaggcggcagtctcagggcttttccgctcc
agtgttcttctattaagcatctatattatcgaaagcatcgccgaaaatatcgccctgcgt
tcacagcttatccattctgaaaaaatgacgattgtgagtgaactggcagcgagcgtcgcc
catgaggtcaggaatccgctgacagttgtccgcgggtttgtccagctgctttttaatgac
gaaaccctacaaaacaagtcgagtgcggattacaaaaagcttgtactgtcagagcttgac
cgggcgcaaggcattatcacaaactatctcgatatggccaaacagcaattatacgaaaaa
gaggtttttgacctatctgcccttatcaaagagacaagctcccttatggtgtcgtacgcc
aattacaagtcagtaaccgtcgaggctgaaacagaaccggaccttttgatatacggagac
gcaacaaagctgaagcaggctgtcatcaacctgatgaaaaacagtattgaagcggttcct
cacgggaaggggatgatccacatatcagccaaaagaaacggccatacgatcatgattaac
atcacagacaatggggtcgggatgacagaccatcaaatgcaaaaactcggcgaaccttat
tattccttaaaaacgaacggaacgggactcggcctcaccgtaaccttttccattattgaa
catcatcacgggaccatttcatttaacagcagcttccaaaaaggcactacggtgaccatt
aagcttcccgctgatcttcctcactag

DBGET integrated database retrieval system