KEGG   Bacillus subtilis subsp. subtilis 168: BSU31460
Entry
BSU31460          CDS       T00010                                 

Symbol
kapB
Name
(RefSeq) kinase-associated lipoprotein B
  KO
K06347  kinase-associated protein B
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU31460 (kapB)
SSDB
Motif
Pfam: KapB Prokineticin
Other DBs
NCBI-GeneID: 938848
NCBI-ProteinID: NP_391024
Pasteur: BG10746
BSORF: BG10746
UniProt: Q08429 A0A6M3ZG29
Position
3231399..3231785
AA seq 128 aa
MSTFETGSIVKGFYKTGVYIGEITACRPQHYLVKVKAVLTHPAQGDLHHPKQADVPFFHE
RKALAYGEQTNIPHHMVKPYDGEVPDYTESLREATAQMRAKLNEDGSEWAKRSLHNLDIL
EKEYFNRP
NT seq 387 nt   +upstreamnt  +downstreamnt
atgagcacgtttgagacaggctctatcgttaaaggattttacaaaacaggtgtatacata
ggagaaatcacggcttgcaggccgcagcattatttagtgaaagtgaaagcggttcttacc
catcccgctcagggagaccttcatcatccaaaacaggcggatgtgccattttttcatgag
agaaaagcgctcgcatatggtgaacagaccaatatcccccaccatatggtgaagccttat
gacggtgaagtgccggattataccgaatctctgcgggaggcgacagcacagatgagagcc
aaattgaatgaggatggttcggagtgggcaaagcgctcccttcataatctggacatttta
gaaaaagaatattttaaccggccataa

DBGET integrated database retrieval system