KEGG   Bacillus subtilis subsp. subtilis 168: BSU31480Help
Entry
BSU31480          CDS       T00010                                 

Gene name
yuxJ
Definition
(RefSeq) MFS transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_1_like Sugar_tr MFS_3
Motif
Other DBs
NCBI-GeneID: 938852
NCBI-ProteinID: NP_391026
Pasteur: BG10976
BSORF: BG10976
UniProt: P40760
Position
3232640..3233818
Genome map
AA seq 392 aa AA seqDB search
MWLANFFVSASTTMIVPFLSLYIETLSSFSNGFVQRWSGYVFGITFLMAFLVSPFWGRFG
DKRGYKKILMATGTGIALSIFFMGFVTSVYQLFFLRMAMGLVTGFIPTSLAMISAQTPKS
SAGKTLGTLQMGQVSGSLFGPLLGGMLADRFGFTYTFFITSFVIFSSVLLVLFGVKEKHL
AEKTAKRTSYSRKEVLSYIFHHPALWVMMLLTMLIQTGNFSIQPLLALYVNELHGPVNLA
FFSGMAFSATGLGSLLLARKWGDLGDRYGHRRILIGLLLAASFFFIPQALASSLSVLLVF
RFLFGMAMGGLLPCITAAIRVQAPGSIQGEVLGYNVSFRFLGNVLGPLLGGIISSHFTIS
ATFYVTAFLFFAGACMLWIMQKLRKDSYAKAS
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
gtgtggctggcgaacttttttgtctccgctagcacaacgatgatcgttccttttctctcc
ttatacattgagacgctcagctctttttcaaacggctttgtgcaaaggtggagcggctat
gtgttcggcattacatttctcatggcgtttttggtatccccgttttggggacggttcgga
gacaaacgcggatacaagaaaatccttatggcaaccggaacaggcattgccctcagcatt
ttcttcatgggctttgttacatcggtgtaccaattgttttttctgcgtatggcaatgggt
cttgtaaccggattcatcccgacatctcttgcgatgatttcggcacagactccgaagagc
tcagctggcaaaacactcggcacgctgcaaatggggcaagtgtccggaagcttgttcggc
ccgcttttgggaggcatgcttgctgatcgtttcggctttacgtataccttttttatcaca
tcctttgtgattttctcgtctgttcttctcgtgttatttggtgtcaaagaaaagcatctt
gcagagaaaacagccaaacgtacgtcttactcgagaaaagaagtgctctcctatattttt
caccatccggcgctgtgggtcatgatgctgttaaccatgctgattcaaacaggcaatttc
agtatccagcccctgctcgctttatatgtaaatgagctgcacggacctgtcaatcttgcc
tttttctccggcatggcattttcagcaacggggctcggaagtttgctgctggctagaaaa
tggggtgatctgggcgaccgctacggccaccgccgcattttaatcggacttttgctcgcc
gcctctttcttttttattccgcaggcgctcgcgtcctcactcagcgtgctccttgttttc
agatttttattcggaatggcgatgggcggtttgctgccatgcattacggcagcgatccgc
gttcaggctcccggcagcattcaaggtgaagttctcggctacaatgtcagctttcgcttt
ttaggaaacgtgctcgggcctctgctcggcggaatcatatcgagccattttaccatttcg
gccaccttttacgtcacggcgtttctctttttcgccggcgcctgcatgctttggatcatg
cagaaacttcggaaagattcttatgccaaagcaagctga

DBGET integrated database retrieval system