KEGG   Bacillus subtilis subsp. subtilis 168: BSU31480
Entry
BSU31480          CDS       T00010                                 

Symbol
yuxJ
Name
(RefSeq) MFS transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MFS_1 MFS_1_like Sugar_tr MFS_3 TMEM192
Other DBs
NCBI-GeneID: 938852
NCBI-ProteinID: NP_391026
Pasteur: BG10976
BSORF: BG10976
UniProt: P40760 A0A6M3ZFS2
Position
3232640..3233818
AA seq 392 aa
MWLANFFVSASTTMIVPFLSLYIETLSSFSNGFVQRWSGYVFGITFLMAFLVSPFWGRFG
DKRGYKKILMATGTGIALSIFFMGFVTSVYQLFFLRMAMGLVTGFIPTSLAMISAQTPKS
SAGKTLGTLQMGQVSGSLFGPLLGGMLADRFGFTYTFFITSFVIFSSVLLVLFGVKEKHL
AEKTAKRTSYSRKEVLSYIFHHPALWVMMLLTMLIQTGNFSIQPLLALYVNELHGPVNLA
FFSGMAFSATGLGSLLLARKWGDLGDRYGHRRILIGLLLAASFFFIPQALASSLSVLLVF
RFLFGMAMGGLLPCITAAIRVQAPGSIQGEVLGYNVSFRFLGNVLGPLLGGIISSHFTIS
ATFYVTAFLFFAGACMLWIMQKLRKDSYAKAS
NT seq 1179 nt   +upstreamnt  +downstreamnt
gtgtggctggcgaacttttttgtctccgctagcacaacgatgatcgttccttttctctcc
ttatacattgagacgctcagctctttttcaaacggctttgtgcaaaggtggagcggctat
gtgttcggcattacatttctcatggcgtttttggtatccccgttttggggacggttcgga
gacaaacgcggatacaagaaaatccttatggcaaccggaacaggcattgccctcagcatt
ttcttcatgggctttgttacatcggtgtaccaattgttttttctgcgtatggcaatgggt
cttgtaaccggattcatcccgacatctcttgcgatgatttcggcacagactccgaagagc
tcagctggcaaaacactcggcacgctgcaaatggggcaagtgtccggaagcttgttcggc
ccgcttttgggaggcatgcttgctgatcgtttcggctttacgtataccttttttatcaca
tcctttgtgattttctcgtctgttcttctcgtgttatttggtgtcaaagaaaagcatctt
gcagagaaaacagccaaacgtacgtcttactcgagaaaagaagtgctctcctatattttt
caccatccggcgctgtgggtcatgatgctgttaaccatgctgattcaaacaggcaatttc
agtatccagcccctgctcgctttatatgtaaatgagctgcacggacctgtcaatcttgcc
tttttctccggcatggcattttcagcaacggggctcggaagtttgctgctggctagaaaa
tggggtgatctgggcgaccgctacggccaccgccgcattttaatcggacttttgctcgcc
gcctctttcttttttattccgcaggcgctcgcgtcctcactcagcgtgctccttgttttc
agatttttattcggaatggcgatgggcggtttgctgccatgcattacggcagcgatccgc
gttcaggctcccggcagcattcaaggtgaagttctcggctacaatgtcagctttcgcttt
ttaggaaacgtgctcgggcctctgctcggcggaatcatatcgagccattttaccatttcg
gccaccttttacgtcacggcgtttctctttttcgccggcgcctgcatgctttggatcatg
cagaaacttcggaaagattcttatgccaaagcaagctga

DBGET integrated database retrieval system