KEGG   Bacillus subtilis subsp. subtilis 168: BSU31490Help
Entry
BSU31490          CDS       T00010                                 

Gene name
pbpD
Definition
(RefSeq) penicillin-binding protein 4
  KO
K18770  penicillin-binding protein 4 [EC:2.4.1.129 3.4.16.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BSU31490 (pbpD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bsu01003]
    BSU31490 (pbpD)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
    BSU31490 (pbpD)
Enzymes [BR:bsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     BSU31490 (pbpD)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BSU31490 (pbpD)
Glycosyltransferases [BR:bsu01003]
 Polysaccharide
  Bacterial polysaccharide
   BSU31490 (pbpD)
Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   BSU31490 (pbpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase
Motif
Other DBs
NCBI-GeneID: 938851
NCBI-ProteinID: NP_391027
Pasteur: BG10977
BSORF: BG10977
UniProt: P40750
Position
3233911..3235785
Genome map
AA seq 624 aa AA seqDB search
MTMLRKIIGWILLLCIIPLFAFTVIASGKEVKQMKSLDQVLDKNIDLKDISLVQNSYMYD
RDGSLVSEIVSDHENRVLVPFNKIPEEVKQIFLTSEDRHFYEHKGFDFMGMVRATASNVK
DKKIDQGASTITQQLSRNLYLSHERSFSRKLTELAYSYQLEKKYTKNEILEAYLNTIYFN
NGVYGVGSAAQFYFSKPLKSLTVGEMAFICAIPNNPTLYDPLKHFDYTKSRQERLLKGLK
DAGVITDKELKKAVKQKIKLDVEKREDKYPDYVSYVNDEFTQLVSESEGFDKRLQKASGK
QKEKIENELSARVSTLMKDGVKIYTALDPYMQNQVVAQMNSKLPYADVQGGAAVINHQTH
QIIALSGGKNYQKYDFNRAYQAYRQPGSSIKPLLDYGPYIEQTGATTSSTIDASKFCSKD
YCPQNYNNRTYGTVTLDTAFKNSYNTPAIRMLDRVGIQKAFSYIEPYHFAKLVDSDYLLP
AALGGFTNGMTPLEMTKAYTTFGNSGSYTPSHAITKVTDLKGKTLYKWNDKATQIFSVRT
NMQLKKLMSSVVKSGTGKKAYFNAPYIGGKTGTSNDYHDMWFVGLTDTYTMGVWVGKDTP
TSVEYLHSISPQLSIWKGTLQAAY
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatgttacgaaaaataatcggatggattttgctcctttgcataatcccattgttt
gcatttacagttatcgcttccggaaaagaagtaaaacaaatgaagtccctggatcaggtg
cttgataaaaatattgatctgaaagatatcagccttgttcagaacagctacatgtatgac
agggacggctcccttgtctcggaaatcgtcagcgaccacgaaaaccgtgtgctcgttcca
tttaacaagattcccgaggaagtcaaacagattttcttaacatctgaggaccgccatttt
tacgagcataaaggctttgactttatgggaatggtgcgggctactgcttctaacgtaaaa
gacaagaaaattgaccagggtgccagcaccatcacacagcagctttcaagaaacttgtat
ttgagccacgaacgctccttcagccgcaagctgacagagctcgcgtattcctatcagctg
gagaaaaaatatacgaaaaatgaaattcttgaagcttacttaaataccatttatttcaac
aacggtgtttacggcgtcggttcagcagctcaattctatttcagcaaaccgctgaaatct
ctcacagtgggagaaatggcttttatctgtgctatacctaataaccctacattatatgat
cctctcaagcattttgactacacgaaaagccgtcaagaacgtttacttaaagggctaaaa
gatgccggggtcattacggacaaagagctgaaaaaagccgtaaaacaaaaaatcaaactg
gatgttgaaaaaagagaagacaaatatcctgactacgtttcctacgtcaatgatgaattc
actcagctggtgtctgaatcagaaggctttgataaacgccttcaaaaagcatcaggaaaa
caaaaagaaaagatcgagaacgagctgtccgcaagagtcagcacgctgatgaaagacgga
gtgaaaatttatactgcacttgatccgtacatgcaaaatcaagttgtggcacaaatgaat
tccaagctcccgtatgcggacgtacagggcggagcggctgtgattaatcaccagacgcat
caaatcattgctctatccggcgggaaaaactatcaaaaatatgactttaaccgcgcctac
caggcgtacaggcagccgggttcatccattaagccgcttcttgattacggcccttatatt
gaacagaccggcgcgacaacaagcagcaccattgatgccagcaagttttgcagcaaagac
tactgtccgcaaaactacaataaccgcacttacggcacagtgacgcttgatacggcgttt
aaaaattcatataataccccggctattagaatgctcgaccgcgtcggcatccaaaaggca
ttcagttatattgagccgtatcattttgccaaacttgtcgacagtgactatcttcttccg
gcggcgcttggcggatttacaaacggcatgacgcctcttgagatgacaaaggcttatacg
acattcggaaacagcggaagctatacgccgagccatgcgattacaaaggtgacagacctt
aaaggaaaaacactttataaatggaatgataaagcgactcaaatattcagcgtccgcacg
aacatgcagctgaaaaaactgatgtcttccgttgtgaaaagcggaacagggaaaaaagca
tatttcaatgcgccttacatcggcggtaaaaccggaacatcaaatgattatcacgatatg
tggtttgtcggcctgactgatacgtatacaatgggtgtctgggtcggaaaggatacaccg
accagcgttgaatatcttcacagcatcagccctcagctttccatctggaaaggaacgctg
caagcggcttattaa

DBGET integrated database retrieval system