KEGG   Bacillus subtilis subsp. subtilis 168: BSU31500
Entry
BSU31500          CDS       T00010                                 

Gene name
yuxK
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DCC1-like
Other DBs
NCBI-GeneID: 938854
NCBI-ProteinID: NP_391028
Pasteur: BG10978
BSORF: BG10978
UniProt: P40761 A0A6M3ZG17
Position
3235806..3236219
AA seq 137 aa
MTSEQIPNRVLLFDGVCNLCNGAVQFIIKRDPDGLISFTSLQSETGQSLLKKSGLPTDRF
DSFVFIEDGQVYTKSTAAIKVFRHLRGPWRLFVLFFAVPKPVRDMVYSFIAKNRYKWFGK
KNECMLPSPSIKKRFLP
NT seq 414 nt   +upstreamnt  +downstreamnt
gtgacttcagaacaaattccaaatcgcgttttgctgtttgacggtgtctgcaatttatgc
aatggcgccgtgcagtttatcattaaacgtgatccggacggattgatttctttcacatcg
ctgcagtcggaaacaggacagagcctgctgaaaaaaagcgggcttccgactgatcggttt
gacagctttgtctttattgaagacggccaagtgtacacaaagtcaactgcagccattaag
gttttcaggcatctgcgaggcccatggcggctcttcgtcctttttttcgcagtgccgaag
cctgtcagagatatggtctattctttcattgccaaaaaccgctataagtggtttggcaaa
aaaaatgaatgtatgctcccctccccttccattaaaaaaagatttttaccgtaa

DBGET integrated database retrieval system