KEGG   Bacillus subtilis subsp. subtilis 168: BSU31510
Entry
BSU31510          CDS       T00010                                 

Gene name
yufK
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF5366
Other DBs
NCBI-GeneID: 938853
NCBI-ProteinID: NP_391029
Pasteur: BG12346
BSORF: BG12346
UniProt: O05249 A0A6M3ZKH2
Position
complement(3236422..3236979)
AA seq 185 aa
MKNTYLTGYFPLIAILLFSSSLSISTSLYALKMLSSFGMYDGMLDYFSEKGIRLALFAAF
ALLYFMVLSALKLIANTVTELSLLFFANDPEGNNLKKLRMGSMIYLGGGILSFVLLQNVI
WIVIWFAVVTLAYFVFTVYRIYSTLSLMSLVGFILLELLFWFTFVIGILFIFIKLYNSIM
ASLPV
NT seq 558 nt   +upstreamnt  +downstreamnt
atgaaaaatacttatttgacaggatattttccgctgattgcgatcctgctttttagttcg
tccttatccatctcaacttcactttatgcgttgaagatgctgtcttcatttggaatgtat
gatggaatgctcgattatttttcagagaaaggaatcaggcttgcgttatttgctgccttt
gcacttttatattttatggttctgtccgctctgaaattaattgcaaataccgtgaccgag
ctgtcattgctgttttttgctaatgatccggaagggaacaacctgaaaaaactcagaatg
ggttccatgatttatttgggcggcgggattttatcctttgtgctcttgcaaaatgtcatt
tggattgtgatctggtttgcggtcgtcacgctcgcttactttgtgtttaccgtataccgg
atttattcgacgctttctctcatgtcattagttggattcattctattggaactgctgttt
tggtttacctttgttatcggtattctgttcatatttatcaagctttataatagcataatg
gctagcttacctgtgtaa

DBGET integrated database retrieval system