KEGG   Bacillus subtilis subsp. subtilis 168: BSU31530Help
Entry
BSU31530          CDS       T00010                                 

Gene name
yufM
Definition
(RefSeq) transcriptional regulatory protein MalR
  KO
K11615  two-component system, CitB family, response regulator MalR
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Module
bsu_M00490  MalK-MalR (malate transport) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU31530 (yufM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU31530 (yufM)
Two-component system [BR:bsu02022]
 CitB family
  MalK-MalR [MD:M00490]
   BSU31530 (yufM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg HTH_11 HTH_Mga HTH_36 FaeA HTH_5
Motif
Other DBs
NCBI-GeneID: 937174
NCBI-ProteinID: NP_391031
Pasteur: BG12348
BSORF: BG12348
UniProt: O05251
Position
3238751..3239458
Genome map
AA seq 235 aa AA seqDB search
MINVLIVEDDPMVGELNKRYLSQIDGFQLKGIASSFQSALHILGEHHIDLILLDIYMPGK
NGLELLTELRAQNEAVDVIVISAASELDVIKKTLRYGAVDYLIKPFEFERFQTALSDYRR
KQKVYSTHRNMSQKELDAELFQKKEATEKVQLPKGLTKSTLKLIWSSIQSFENESFTTED
LAKHTEISQVSIRKYLKFLEDIQVLNVEMAYGTIGRPVFQYNVNNSNINGIKQYL
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgattaatgtactaatagttgaagatgaccccatggtgggtgaattaaataaacgatac
ttaagccaaatagatggctttcagctgaaaggcatcgcttcttcctttcaaagcgctctg
catattttaggggagcaccatattgacctcattttgcttgatatttatatgccgggaaaa
aacgggctggaactgctgacggaattgagagcccaaaatgaagcggttgacgtgattgtc
atctcagcggccagcgagcttgacgtgatcaagaaaacacttcggtacggagctgttgat
tatttaatcaaaccgtttgaatttgaacgattccaaacggctctgtctgattacagacga
aaacaaaaggtgtattcaacccatcgcaacatgagccaaaaagaactggacgccgagctt
tttcaaaagaaagaagcaacagaaaaagtgcagcttcctaaaggcctgacaaaaagcacg
ctgaagctgatctggtccagtatccagtcatttgaaaatgaatcttttacgacagaagac
ttggcaaagcacacagaaatctctcaagtatccatacgaaaatacttaaagtttcttgaa
gatatacaggttctgaatgtagaaatggcgtacggaacgatcggaagacctgtgtttcag
tacaacgtcaacaacagtaacattaacggaataaagcaatatctataa

DBGET integrated database retrieval system