KEGG   Bacillus subtilis subsp. subtilis 168: BSU31530
Entry
BSU31530          CDS       T00010                                 

Symbol
yufM
Name
(RefSeq) transcriptional regulatory protein MalR
  KO
K11615  two-component system, CitB family, response regulator MalR
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU31530 (yufM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU31530 (yufM)
Two-component system [BR:bsu02022]
 CitB family
  MalK-MalR (malate transport)
   BSU31530 (yufM)
SSDB
Motif
Pfam: Response_reg HTH_11 HTH_Mga FaeA HTH_5 HTH_36 HTH_41
Other DBs
NCBI-GeneID: 937174
NCBI-ProteinID: NP_391031
Pasteur: BG12348
BSORF: BG12348
UniProt: O05251 A0A6M4JMG3
Position
3238751..3239458
AA seq 235 aa
MINVLIVEDDPMVGELNKRYLSQIDGFQLKGIASSFQSALHILGEHHIDLILLDIYMPGK
NGLELLTELRAQNEAVDVIVISAASELDVIKKTLRYGAVDYLIKPFEFERFQTALSDYRR
KQKVYSTHRNMSQKELDAELFQKKEATEKVQLPKGLTKSTLKLIWSSIQSFENESFTTED
LAKHTEISQVSIRKYLKFLEDIQVLNVEMAYGTIGRPVFQYNVNNSNINGIKQYL
NT seq 708 nt   +upstreamnt  +downstreamnt
atgattaatgtactaatagttgaagatgaccccatggtgggtgaattaaataaacgatac
ttaagccaaatagatggctttcagctgaaaggcatcgcttcttcctttcaaagcgctctg
catattttaggggagcaccatattgacctcattttgcttgatatttatatgccgggaaaa
aacgggctggaactgctgacggaattgagagcccaaaatgaagcggttgacgtgattgtc
atctcagcggccagcgagcttgacgtgatcaagaaaacacttcggtacggagctgttgat
tatttaatcaaaccgtttgaatttgaacgattccaaacggctctgtctgattacagacga
aaacaaaaggtgtattcaacccatcgcaacatgagccaaaaagaactggacgccgagctt
tttcaaaagaaagaagcaacagaaaaagtgcagcttcctaaaggcctgacaaaaagcacg
ctgaagctgatctggtccagtatccagtcatttgaaaatgaatcttttacgacagaagac
ttggcaaagcacacagaaatctctcaagtatccatacgaaaatacttaaagtttcttgaa
gatatacaggttctgaatgtagaaatggcgtacggaacgatcggaagacctgtgtttcag
tacaacgtcaacaacagtaacattaacggaataaagcaatatctataa

DBGET integrated database retrieval system