KEGG   Bacillus subtilis subsp. subtilis 168: BSU31540
Entry
BSU31540          CDS       T00010                                 

Gene name
yufN
Definition
(RefSeq) lipoprotein
  KO
K07335  basic membrane protein A and related proteins
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU31540 (yufN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU31540 (yufN)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   General nucleoside transporter
    BSU31540 (yufN)
SSDB
Motif
Pfam: Bmp
Other DBs
NCBI-GeneID: 938870
NCBI-ProteinID: NP_391032
Pasteur: BG12349
BSORF: BG12349
UniProt: O05252 A0A6M4JNA1
Position
3239930..3241009
AA seq 359 aa
MNKRKIGLAMSLVIAAGTILGACGNSEKSSGSGEGKNKFSVAMVTDVGGVDDKSFNQSAW
EGIQAFGKENGLKKGKNGYDYLQSKSDADYTTNLNKLARENFDLIYGVGYLMEDSISEIA
DQRKNTNFAIIDAVVDKDNVASITFKEQEGSFLVGVAAALSSKSGKIGFVGGMESELIKK
FEVGFRAGVQAVNPKAVVEVKYAGGFDKADVGKATAESMYKSGVDVIYHSAGATGTGVFT
EAKNLKKEDPKRDVWVIGVDKDQYAEGQVEGTDDNVTLTSMVKKVDTVVEDVTKKASDGK
FPGGETLTYGLDQDGVGISPSKQNLSDDVIKAVDKWKKKIIDGLEIPATEKELKTFKAE
NT seq 1080 nt   +upstreamnt  +downstreamnt
ttgaataaacgaaaaatcggattggcgatgtcacttgtgatcgcagcaggcaccatatta
ggagcatgcggaaacagcgaaaaaagcagcggctcaggcgaaggcaaaaacaaattcagt
gtggcgatggttactgacgtaggcggagtggatgacaaatccttcaaccaatcagcctgg
gaaggcatccaagcctttgggaaagagaatgggctgaaaaaaggcaaaaacggttacgac
tatcttcaatccaaatctgatgcagactatacaacgaacttaaataaattggcgcgtgag
aattttgacttaatttacggcgtcggctacttaatggaggattcaatcagcgaaattgct
gaccagcgtaaaaatacaaactttgcgattatagatgctgttgtcgataaagacaacgtc
gcaagtattacgtttaaagagcaggaaggctcatttctcgtcggagtggccgcagcccta
tcaagcaaatcaggaaaaatcggctttgtaggcggcatggaatcagagttgatcaaaaaa
ttcgaggtcggcttccgtgccggcgtgcaagcagttaaccctaaagccgttgtagaagtg
aaatacgcagggggtttcgataaagccgatgtcggtaaagcaaccgccgaaagcatgtat
aaatcaggcgtagatgttatttatcactctgcgggcgccactggcacaggcgtctttact
gaagcgaaaaacctgaaaaaagaagatccaaaacgcgatgtctgggtcatcggtgtcgat
aaagaccaatacgcagaaggccaggtagaaggaacagatgataacgtcaccctcacttcc
atggtgaaaaaagtagatacagtcgttgaagatgtaacgaaaaaagcgagtgacggaaag
ttcccgggcggcgaaacacttacctacgggcttgatcaagacggagtcggcatttctcca
tctaaacaaaatctatcggatgatgtgatcaaagcggtcgataaatggaagaaaaaaatc
atcgacggattggaaatcccggcaactgagaaagagctgaaaaccttcaaagctgaataa

DBGET integrated database retrieval system