KEGG   Bacillus subtilis subsp. subtilis 168: BSU31540Help
Entry
BSU31540          CDS       T00010                                 

Gene name
yufN
Definition
(RefSeq) lipoprotein
  KO
K07335  basic membrane protein A and related proteins
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99993 Cell motility
    BSU31540 (yufN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bmp
Motif
Other DBs
NCBI-GeneID: 938870
NCBI-ProteinID: NP_391032
Pasteur: BG12349
BSORF: BG12349
UniProt: O05252
Position
3239930..3241009
Genome map
AA seq 359 aa AA seqDB search
MNKRKIGLAMSLVIAAGTILGACGNSEKSSGSGEGKNKFSVAMVTDVGGVDDKSFNQSAW
EGIQAFGKENGLKKGKNGYDYLQSKSDADYTTNLNKLARENFDLIYGVGYLMEDSISEIA
DQRKNTNFAIIDAVVDKDNVASITFKEQEGSFLVGVAAALSSKSGKIGFVGGMESELIKK
FEVGFRAGVQAVNPKAVVEVKYAGGFDKADVGKATAESMYKSGVDVIYHSAGATGTGVFT
EAKNLKKEDPKRDVWVIGVDKDQYAEGQVEGTDDNVTLTSMVKKVDTVVEDVTKKASDGK
FPGGETLTYGLDQDGVGISPSKQNLSDDVIKAVDKWKKKIIDGLEIPATEKELKTFKAE
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
ttgaataaacgaaaaatcggattggcgatgtcacttgtgatcgcagcaggcaccatatta
ggagcatgcggaaacagcgaaaaaagcagcggctcaggcgaaggcaaaaacaaattcagt
gtggcgatggttactgacgtaggcggagtggatgacaaatccttcaaccaatcagcctgg
gaaggcatccaagcctttgggaaagagaatgggctgaaaaaaggcaaaaacggttacgac
tatcttcaatccaaatctgatgcagactatacaacgaacttaaataaattggcgcgtgag
aattttgacttaatttacggcgtcggctacttaatggaggattcaatcagcgaaattgct
gaccagcgtaaaaatacaaactttgcgattatagatgctgttgtcgataaagacaacgtc
gcaagtattacgtttaaagagcaggaaggctcatttctcgtcggagtggccgcagcccta
tcaagcaaatcaggaaaaatcggctttgtaggcggcatggaatcagagttgatcaaaaaa
ttcgaggtcggcttccgtgccggcgtgcaagcagttaaccctaaagccgttgtagaagtg
aaatacgcagggggtttcgataaagccgatgtcggtaaagcaaccgccgaaagcatgtat
aaatcaggcgtagatgttatttatcactctgcgggcgccactggcacaggcgtctttact
gaagcgaaaaacctgaaaaaagaagatccaaaacgcgatgtctgggtcatcggtgtcgat
aaagaccaatacgcagaaggccaggtagaaggaacagatgataacgtcaccctcacttcc
atggtgaaaaaagtagatacagtcgttgaagatgtaacgaaaaaagcgagtgacggaaag
ttcccgggcggcgaaacacttacctacgggcttgatcaagacggagtcggcatttctcca
tctaaacaaaatctatcggatgatgtgatcaaagcggtcgataaatggaagaaaaaaatc
atcgacggattggaaatcccggcaactgagaaagagctgaaaaccttcaaagctgaataa

DBGET integrated database retrieval system