KEGG   Bacillus subtilis subsp. subtilis 168: BSU31550Help
Entry
BSU31550          CDS       T00010                                 

Gene name
yufO
Definition
(RefSeq) ABC transporter ATP-binding protein
  KO
K02056  simple sugar transport system ATP-binding protein [EC:3.6.3.17]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU31550 (yufO)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.17  monosaccharide-transporting ATPase
     BSU31550 (yufO)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative simple sugar transporter [MD:M00221]
    BSU31550 (yufO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N RsgA_GTPase AAA_29 MMR_HSR1 AAA_15 AAA_23 Bac_DnaA AAA_27 AAA_22 AAA_30
Motif
Other DBs
NCBI-GeneID: 937172
NCBI-ProteinID: NP_391033
Pasteur: BG12350
BSORF: BG12350
UniProt: O05253
Position
3241085..3242617
Genome map
AA seq 510 aa AA seqDB search
MEYVIEMLNIRKAFPGIVANDNINLQVKKGEIHALLGENGAGKSTLMNVLFGLYQPERGE
IRVRGEKVHINSPNKANDLGIGMVHQHFMLVDTFTVAENIILGKEPKKFGRIDRKRAGQE
VQDISDRYGLQIHPEAKAADISVGMQQRAEILKTLYRGADILIFDEPTAVLTPHEIKELM
QIMKNLVKEGKSIILITHKLKEIMEICDRVTVIRKGKGIKTLDVRDTNQDELASLMVGRE
VSFKTEKRAAQPGAEVLAIDGITVKDTRGIETVRDLSLSVKAGEIVGIAGVDGNGQSELI
EAVTGLRKTDSGTITLNGKQIQNLTPRKITESGIGHIPQDRHKHGLVLDFPIGENILLQS
YYKKPYSALGVLHKGEMYKKARSLITEYDVRTPDEYTHARALSGGNQQKAIIGREIDRNP
DLLIAAQPTRGLDVGAIEFVHKKLIEQRDAGKAVLLLSFELEEIMNLSDRIAVIFEGRII
ASVNPQETTEQELGLLMAGSTQKEAGKANG
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggaatatgtcattgaaatgctcaatatccgcaaggcgtttccaggtatcgtcgccaat
gacaatatcaatcttcaagtcaaaaaaggcgaaatacacgcgttgctcggtgaaaacgga
gcggggaaatcaacattgatgaatgtccttttcgggctgtatcagccggagcggggtgaa
attcgggtgcgcggcgagaaggtgcacatcaacagcccgaacaaagcgaatgaccttgga
attggaatggtgcaccagcactttatgcttgttgacacctttacagttgctgaaaatatt
attctcgggaaggagccaaagaagtttggcagaattgaccggaagcgtgctggccaagag
gtgcaggacatttccgatcgatacggcctgcagatccatcctgaagcaaaagcagctgac
atatcagtcggtatgcagcagcgcgcagaaatattaaaaaccctctaccgcggtgccgac
attctgatttttgatgaaccgacggctgttttgacgcctcatgaaattaaggaactgatg
caaattatgaagaacctggtcaaagaagggaagtccatcatcttaatcacccataagctg
aaagagattatggagatttgtgaccgcgttacggttatccgtaaaggaaaaggcatcaaa
acccttgatgtccgtgatacaaaccaagacgaactcgccagtctaatggtcggccgtgag
gtatcgttcaaaactgaaaagagagctgctcagccgggagcggaagtgcttgcgattgac
ggcataactgtaaaggatacccgcggaatagagacagtcagagatttgtctctttctgtc
aaagcgggagaaatagtcggcatagcaggcgtcgacggaaacgggcaatctgagctgatc
gaagcggtgacaggactccgcaaaacagattcaggaacaatcaccttaaacggaaaacag
atccaaaacctgacgccaagaaaaatcactgaatccgggatcgggcatattcctcaggat
cgccataaacacggtctcgtccttgattttccaatcggagagaatatcctgctgcaaagc
tattacaaaaagccgtattcagcattgggcgttttacataaaggcgaaatgtacaaaaaa
gcacgcagcctgatcactgagtacgatgtcagaacgccggatgaatatacacacgctcgg
gcattgtcaggcggaaaccagcaaaaagcgattatcgggcgggaaatagaccgaaatcct
gatttattaattgccgcccagccgactcgcggccttgatgtcggagcgattgaatttgtc
cataaaaagctcattgagcagcgtgatgccgggaaagccgttcttctcctctcgtttgag
cttgaagaaattatgaatctcagtgacagaatcgccgttatttttgaaggacgcattatc
gccagcgttaatccgcaggaaaccactgaacaggagcttggtctcttgatggcaggaagc
acgcaaaaggaagcggggaaagcaaatggttaa

DBGET integrated database retrieval system