KEGG   Bacillus subtilis subsp. subtilis 168: BSU31550
Entry
BSU31550          CDS       T00010                                 

Gene name
yufO
Definition
(RefSeq) ABC transporter ATP-binding protein
  KO
K23537  general nucleoside transport system ATP-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU31550 (yufO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU31550 (yufO)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   General nucleoside transporter
    BSU31550 (yufO)
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N RsgA_GTPase AAA_29 MMR_HSR1 AAA_23 Bac_DnaA AAA_27 AAA_22 AAA_30
Other DBs
NCBI-GeneID: 937172
NCBI-ProteinID: NP_391033
Pasteur: BG12350
BSORF: BG12350
UniProt: O05253 A0A6M4JLG9
Position
3241085..3242617
AA seq 510 aa
MEYVIEMLNIRKAFPGIVANDNINLQVKKGEIHALLGENGAGKSTLMNVLFGLYQPERGE
IRVRGEKVHINSPNKANDLGIGMVHQHFMLVDTFTVAENIILGKEPKKFGRIDRKRAGQE
VQDISDRYGLQIHPEAKAADISVGMQQRAEILKTLYRGADILIFDEPTAVLTPHEIKELM
QIMKNLVKEGKSIILITHKLKEIMEICDRVTVIRKGKGIKTLDVRDTNQDELASLMVGRE
VSFKTEKRAAQPGAEVLAIDGITVKDTRGIETVRDLSLSVKAGEIVGIAGVDGNGQSELI
EAVTGLRKTDSGTITLNGKQIQNLTPRKITESGIGHIPQDRHKHGLVLDFPIGENILLQS
YYKKPYSALGVLHKGEMYKKARSLITEYDVRTPDEYTHARALSGGNQQKAIIGREIDRNP
DLLIAAQPTRGLDVGAIEFVHKKLIEQRDAGKAVLLLSFELEEIMNLSDRIAVIFEGRII
ASVNPQETTEQELGLLMAGSTQKEAGKANG
NT seq 1533 nt   +upstreamnt  +downstreamnt
atggaatatgtcattgaaatgctcaatatccgcaaggcgtttccaggtatcgtcgccaat
gacaatatcaatcttcaagtcaaaaaaggcgaaatacacgcgttgctcggtgaaaacgga
gcggggaaatcaacattgatgaatgtccttttcgggctgtatcagccggagcggggtgaa
attcgggtgcgcggcgagaaggtgcacatcaacagcccgaacaaagcgaatgaccttgga
attggaatggtgcaccagcactttatgcttgttgacacctttacagttgctgaaaatatt
attctcgggaaggagccaaagaagtttggcagaattgaccggaagcgtgctggccaagag
gtgcaggacatttccgatcgatacggcctgcagatccatcctgaagcaaaagcagctgac
atatcagtcggtatgcagcagcgcgcagaaatattaaaaaccctctaccgcggtgccgac
attctgatttttgatgaaccgacggctgttttgacgcctcatgaaattaaggaactgatg
caaattatgaagaacctggtcaaagaagggaagtccatcatcttaatcacccataagctg
aaagagattatggagatttgtgaccgcgttacggttatccgtaaaggaaaaggcatcaaa
acccttgatgtccgtgatacaaaccaagacgaactcgccagtctaatggtcggccgtgag
gtatcgttcaaaactgaaaagagagctgctcagccgggagcggaagtgcttgcgattgac
ggcataactgtaaaggatacccgcggaatagagacagtcagagatttgtctctttctgtc
aaagcgggagaaatagtcggcatagcaggcgtcgacggaaacgggcaatctgagctgatc
gaagcggtgacaggactccgcaaaacagattcaggaacaatcaccttaaacggaaaacag
atccaaaacctgacgccaagaaaaatcactgaatccgggatcgggcatattcctcaggat
cgccataaacacggtctcgtccttgattttccaatcggagagaatatcctgctgcaaagc
tattacaaaaagccgtattcagcattgggcgttttacataaaggcgaaatgtacaaaaaa
gcacgcagcctgatcactgagtacgatgtcagaacgccggatgaatatacacacgctcgg
gcattgtcaggcggaaaccagcaaaaagcgattatcgggcgggaaatagaccgaaatcct
gatttattaattgccgcccagccgactcgcggccttgatgtcggagcgattgaatttgtc
cataaaaagctcattgagcagcgtgatgccgggaaagccgttcttctcctctcgtttgag
cttgaagaaattatgaatctcagtgacagaatcgccgttatttttgaaggacgcattatc
gccagcgttaatccgcaggaaaccactgaacaggagcttggtctcttgatggcaggaagc
acgcaaaaggaagcggggaaagcaaatggttaa

DBGET integrated database retrieval system