KEGG   Bacillus subtilis subsp. subtilis 168: BSU31560
Entry
BSU31560          CDS       T00010                                 

Gene name
yufP
Definition
(RefSeq) ABC transporter permease
  KO
K23535  general nucleoside transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU31560 (yufP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU31560 (yufP)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   General nucleoside transporter
    BSU31560 (yufP)
SSDB
Motif
Pfam: BPD_transp_2 DUF5424 DUF4307
Other DBs
NCBI-GeneID: 937175
NCBI-ProteinID: NP_391034
Pasteur: BG12351
BSORF: BG12351
UniProt: O05254 A0A6M3ZFJ9
Position
3242610..3243656
AA seq 348 aa
MVKRLSHLLVPLIAIILGLAAGALIMLVSGYSVASGYSALWNGIFGEIYYVGETIRQITP
YILSGLAVAFAFRTGLFNIGVEGQLLVGWTAAVWVGTAFDGPAYIHLPLALITAAAAGGL
WGFIPGILKARFYVHEVIVTIMMNYIALHMTNYIISNVLTDHQDKTGKIHESASLRSPFL
EQITDYSRLHLGIIVALLAAVIMWFIINKSTKGFELRAVGFNQHASQYAGMSVRKNIMTS
MLISGAFAGLAGAMEGLGTFEYAAVKGAFTGVGFDGIAVALLGGNTAVGVVLAACLLGGL
KIGALNMPIESGVPSEVVDIVIAIIILFVASSYAIRFVMGKLKKKGAN
NT seq 1047 nt   +upstreamnt  +downstreamnt
atggttaaacgactctctcatttactcgtgccgctcatcgcaatcatacttggtcttgcg
gccggcgcgttgattatgcttgtgagcggctacagtgtggctagcggatattcggctttg
tggaatgggatattcggagaaatctattatgtcggagaaacaatccggcaaattacgcct
tatattttatccggattggctgtcgcctttgcattccgaaccggactctttaatatcggc
gtcgagggacagctgctcgtcggctggacagcagcggtttgggtcggtacggcgtttgac
ggaccggcatatattcacttgccgctcgcattgattacagcggcagctgcaggaggatta
tgggggtttattcccggcattttgaaagcgcgattttacgttcatgaagtcattgtcacc
attatgatgaattatatcgcgctgcacatgaccaattacatcatttcaaacgtcttgaca
gatcatcaggacaagacggggaaaattcacgaatccgcctccctccgctctccttttctt
gaacagatcaccgattactcacggctgcatttgggaatcatcgttgcccttctcgcagca
gttatcatgtggtttatcatcaacaaatctacaaaaggatttgagctccgggcggtcggg
tttaaccagcacgcttcccagtatgccggcatgagcgtgcggaagaatatcatgacctcc
atgcttatctccggcgcttttgcaggtcttgccggagccatggagggcctagggacattc
gaatacgcagcagtgaaaggcgcatttaccggcgtaggctttgacggtatcgctgtcgct
cttctcgggggaaacacagccgtaggcgttgtactggcagcatgcctgcttggcgggctg
aaaatcggcgcattaaatatgccgattgaatcaggcgttccatcagaggtcgttgatatt
gtgattgccattattattctatttgtggcttcaagctatgcgattcgtttcgtcatgggc
aaattgaagaaaaagggggcgaactaa

DBGET integrated database retrieval system