KEGG   Bacillus subtilis subsp. subtilis 168: BSU31580Help
Entry
BSU31580          CDS       T00010                                 

Gene name
maeN
Definition
(RefSeq) Na(+)-malate symporter
  KO
K11616  malate:Na+ symporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU31580 (maeN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2HCT
Motif
Other DBs
NCBI-GeneID: 938855
NCBI-ProteinID: NP_391036
Pasteur: BG12353
BSORF: BG12353
UniProt: O05256
Position
3244770..3246116
Genome map
AA seq 448 aa AA seqDB search
MGAIPKTGTISPEQKDSQEKNLFQKIWSWEIGVIPLPLYTVLAVIIILAAYYNELPANML
GGFAIIMILGVFLGDIGQRIPILKDIGGPAILSLFVPSFLVFYNVLNSTSLDAVTNLMKT
SNFLYFYIACLVVGSILGMNRIVLIQGFIRMFVPLVAGTIAAVAAGILVGFIFGYSAYDS
FFFVVVPIIAGGIGEGILPLSIAYSQILGSSADVFVSQLVPAAIIGNVFAIICAALMKKL
GDKRPDLNGNGRLVKSKKANEIFNQKEAEAKIDFKLMGAGVLLACTFFIFGGLLEKFIFI
PGAILMIISAAAVKYANILPKKMEEGAYQLYKFISSSFTWPLMVGLGILFIPLDDVASVI
SIPFVIICISVVIAMIGSGYFVGKLMNMYPVESAIVTCCHSGLGGTGDVAILSASGRMGL
MPFAQISTRLGGAGTVICATVLLRFFTS
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgggagcaattccaaaaacggggacaatttcacctgagcaaaaagactcacaggagaaa
aacctgtttcaaaaaatttggtcttgggaaatcggtgtgattcctttgccattatacaca
gtattagctgttattattattcttgcagcatattacaatgagctgccggcaaatatgctt
ggcgggtttgccatcattatgattcttggtgtgtttctcggagacataggccaacgcata
ccgatattgaaggatattggcggccctgctattttatctttgtttgttccttcattttta
gtcttttacaatgtactgaattcaacatctttagacgctgtaaccaacttgatgaaaacg
tctaacttcctttatttctatatcgcttgccttgttgtgggaagtatcctcggtatgaac
agaattgttttaatacaggggtttatcagaatgttcgttccactggttgcaggaacgatc
gcggccgttgcagccggcatccttgtcggatttatttttggctatagtgcctatgattcc
tttttctttgttgttgtcccgattattgccgggggaataggtgaagggattttgccgctt
tcaatcgcctattcacaaatactgggctcatccgccgatgtatttgtgtctcagctggtg
ccagccgcaattataggaaacgtttttgctatcatatgtgcagccttaatgaaaaagctt
ggcgacaagcgtccagatctaaatgggaacggacgtctcgtaaaatctaaaaaagcaaat
gagattttcaatcaaaaagaagccgaagcaaaaattgattttaaactaatgggagcagga
gttctgctcgcgtgtacattctttatttttggcgggttattggagaaattcatcttcatc
ccgggcgcgatcttaatgattatttcagctgcggctgtcaagtatgcaaatattcttccg
aaaaaaatggaagaaggcgcttaccagctttataagtttatttcttcaagctttacatgg
ccgctgatggtcggtctcggcatcctctttattccgttggatgacgtagcgtctgtgatt
tctataccgtttgtcatcatctgtatttcagttgttatcgcgatgattggttctggatat
ttcgtaggcaagctgatgaacatgtatccggttgaatccgcaatcgttacctgctgccac
agcggtctcggcggaacgggtgatgttgccattttatcggcatcaggaagaatgggcctt
atgccgtttgcccaaatttcaacccgtctcggcggtgcaggcacagttatttgcgcgaca
gtgctgcttcgttttttcacttcataa

DBGET integrated database retrieval system