KEGG   Bacillus subtilis subsp. subtilis 168: BSU31590Help
Entry
BSU31590          CDS       T00010                                 

Gene name
yufS
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 938856
NCBI-ProteinID: NP_391037
Pasteur: BG12354
BSORF: BG12354
UniProt: O05257
Position
complement(3246152..3246367)
Genome map
AA seq 71 aa AA seqDB search
MKTKVVMCSGLFCSVFAGAFMLNQYDGRSGVAACDEWELYLLEHHLSARMSETESKDLPF
GPREYIRIVNK
NT seq 216 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaacaaaagtcgtgatgtgctcaggtttattctgctcagtatttgcaggggcattc
atgttgaatcaatatgacgggcgcagcggtgtggcggcttgtgatgagtgggagctgtat
ttactggagcaccacctgtcagccagaatgagtgagacggaatcaaaggatctgccgttt
ggtccccgagagtatattcggattgtgaataaataa

DBGET integrated database retrieval system