KEGG   Bacillus subtilis subsp. subtilis 168: BSU31610Help
Entry
BSU31610          CDS       T00010                                 

Gene name
mrpB
Definition
(RefSeq) Na(+)/H(+) antiporter subunit B
  KO
K05566  multicomponent Na+:H+ antiporter subunit B
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU31610 (mrpB)
Transporters [BR:bsu02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU31610 (mrpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MnhB
Motif
Other DBs
NCBI-GeneID: 937177
NCBI-ProteinID: NP_391039
Pasteur: BG12356
BSORF: BG12356
UniProt: O05259
Position
3248996..3249427
Genome map
AA seq 143 aa AA seqDB search
MNEQKTNDLILQTATKLVSFIILLFSFYLFLSGHNAPGGGFVGGLITSSSIVLLLLAYDL
KTVRSLLPVNFIYVAGAGLLLAVLTGVGSFVFGAPFLTHTFGYFQLPILGKTELATATIF
DLGVYLVVVGITMTIIQTIGEEE
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgaacaaaaaacaaatgacttgattcttcaaaccgcgacaaagcttgtatccttt
atcattttgcttttctctttctatttatttttatcagggcataacgcgcccggaggaggc
tttgtcggcggactgatcacgtcctcttccatcgttctcttgctcttggcatatgattta
aaaaccgtgcgttcccttttgcctgtcaatttcatttatgtcgcgggagccggccttctg
ctcgctgtattaacaggcgttggctcctttgtcttcggggctccttttttaacccacaca
ttcggatactttcagctgccgatccttgggaaaacggagctcgccacagcgacgatattt
gatttaggcgtttatcttgttgtcgtaggcataacgatgaccattattcaaacgattgga
gaggaagaataa

DBGET integrated database retrieval system