KEGG   Bacillus subtilis subsp. subtilis 168: BSU31620Help
Entry
BSU31620          CDS       T00010                                 

Gene name
mrpC
Definition
(RefSeq) Na(+)/H(+) antiporter subunit C
  KO
K05567  multicomponent Na+:H+ antiporter subunit C
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU31620 (mrpC)
Transporters [BR:bsu02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU31620 (mrpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_q2
Motif
Other DBs
NCBI-GeneID: 937139
NCBI-ProteinID: NP_391040
Pasteur: BG12357
BSORF: BG12357
UniProt: O05260
Position
3249427..3249768
Genome map
AA seq 113 aa AA seqDB search
MEILMAVLAGIIFMAATYLLLSKSLLRVIIGTALLSHGVHLMLLTMGGLKKGAAPILSEH
AKSFVDPLPQALILTAIVISFGVTSFILVMAFRAYQELKSDDMDQMRGNDQHE
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcttaatggctgtattagccggtattatttttatggctgctacgtatttgctg
ctgtctaaaagcctgcttcgcgtcattatcggaacagcactgttaagccatggcgttcat
ttaatgcttttgactatgggaggattaaagaaaggcgccgctccgattttgagcgagcat
gccaaatcatttgtcgatccgcttccgcaagccctgattttgaccgcaattgtcatttct
tttggcgttacgtcattcatcctcgtcatggcctttcgcgcttatcaggaattgaaatcg
gacgatatggatcaaatgaggggaaatgatcaacatgaataa

DBGET integrated database retrieval system