KEGG   Bacillus subtilis subsp. subtilis 168: BSU31620
Entry
BSU31620          CDS       T00010                                 

Symbol
mrpC
Name
(RefSeq) Na(+)/H(+) antiporter subunit C
  KO
K05567  multicomponent Na+:H+ antiporter subunit C
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU31620 (mrpC)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU31620 (mrpC)
SSDB
Motif
Pfam: Oxidored_q2 DUF6518
Other DBs
NCBI-GeneID: 937139
NCBI-ProteinID: NP_391040
Pasteur: BG12357
BSORF: BG12357
UniProt: O05260 A0A6M4JMV3
Position
3249427..3249768
AA seq 113 aa
MEILMAVLAGIIFMAATYLLLSKSLLRVIIGTALLSHGVHLMLLTMGGLKKGAAPILSEH
AKSFVDPLPQALILTAIVISFGVTSFILVMAFRAYQELKSDDMDQMRGNDQHE
NT seq 342 nt   +upstreamnt  +downstreamnt
atggaaatcttaatggctgtattagccggtattatttttatggctgctacgtatttgctg
ctgtctaaaagcctgcttcgcgtcattatcggaacagcactgttaagccatggcgttcat
ttaatgcttttgactatgggaggattaaagaaaggcgccgctccgattttgagcgagcat
gccaaatcatttgtcgatccgcttccgcaagccctgattttgaccgcaattgtcatttct
tttggcgttacgtcattcatcctcgtcatggcctttcgcgcttatcaggaattgaaatcg
gacgatatggatcaaatgaggggaaatgatcaacatgaataa

DBGET integrated database retrieval system