KEGG   Bacillus subtilis subsp. subtilis 168: BSU31630Help
Entry
BSU31630          CDS       T00010                                 

Gene name
mrpD
Definition
(RefSeq) Na(+)/H(+) antiporter subunit D
  KO
K05568  multicomponent Na+:H+ antiporter subunit D
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU31630 (mrpD)
Transporters [BR:bsu02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU31630 (mrpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Proton_antipo_M NADHdeh_related
Motif
Other DBs
NCBI-GeneID: 938858
NCBI-ProteinID: NP_391041
Pasteur: BG12345
BSORF: BG12345
UniProt: O05229
Position
3249761..3251242
Genome map
AA seq 493 aa AA seqDB search
MNNFVILPILIPLLSAILLIFMTKNLMLMRIFSTAASAIGIVISGILVQTVFTKGIQTLS
LGGWKAPYGIVLAADQFASLLVLTTAIIGLLVGLYSFRSVGEKRERSFYYSGVQFLLAGV
SGAFLTGDLFNMYVFFELLLIASYMLIVLGGTKIQLRESLKYIVFNIVSSALFVIGVGFL
YAVTGTLNMADLSVKISESGQTGLITVIGVLLLLVFGMKGGIFPLYFWLPGSYYAPPAAI
SALFGALLTKVGLYAITRVFTLIFIHDTAFTHQLMIWLAALTVIFGVIGSLAYSNVMKIV
IYNIITAVGVILFGVAVHTPASIQGAIYYLIHDMLIKGALFMLAGTLIALTGTASLHKMG
GLIKRYPVLGWMFFISAISLAGIPPLSGFVGKFKIAEGGFAEGEFTISMLILLSSLLVLY
SVLRIFIHAFWGEEKETPKPNHRTAKGLLYPAAIFLLLSLLFGLGTEWVSPYVDQAAETL
LNPEKYIEAVLKE
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaataattttgttattttgccaatcctgatcccgcttttgtcggctattcttctgatt
ttcatgacgaagaatcttatgctcatgagaatcttcagcacggcggcatcggccatcggg
attgtgattagcggcatacttgtacagactgtcttcacaaaaggcatccagacactcagc
ctaggcggatggaaagcgccgtacggcattgtgcttgccgcagaccaattcgccagcctt
ctcgttctcacaacagcgatcatcggtttattggttgggctttattccttccgttctgtc
ggtgaaaaacgggagcgctccttttactactccggcgttcagttcttgcttgccggcgtc
agcggagcgtttttaacaggcgatttatttaatatgtacgtattttttgagcttctgctt
attgcttcctatatgctgattgtattaggcggcacaaaaattcagctgcgggaatccctt
aaatatattgtgtttaatattgtatcgtctgccctgtttgtcataggggtcggcttttta
tacgctgtaaccggtacgttaaacatggcggatcttagcgtgaaaatcagcgaatcagga
caaaccgggctgatcactgtgattggtgtcctgctgcttttggtatttggcatgaagggc
ggaatcttccccctctacttttggcttccaggctcttattacgcgccaccggcggcaatc
tccgcgttgttcggcgctttgctgacaaaagtcgggttatatgcgattacgagggttttc
acattgatttttattcacgatacagcctttacccatcagttgatgatttggctggcggcg
ctgactgtgatttttggtgtgatcggttcactcgcttattcgaatgtcatgaaaattgtg
atctataacattattaccgctgtcggcgtgattttgttcggtgtggcagtacacaccccc
gcatccattcagggcgcgatctactatctgattcacgatatgctgattaagggcgctttg
ttcatgctggcaggtacgctgatcgcattgactggaaccgcgagcctgcataaaatgggc
gggctgatcaaacgctatcctgttcttggatggatgtttttcatttccgctatttctctt
gcaggcattccgccactgagcggatttgtcggcaaatttaaaattgcagagggcggcttc
gcagaaggtgaatttacgatatccatgctgattctgctttcgagtctgcttgtactgtac
tctgtgctgaggatctttatacatgcgttttggggcgaagaaaaagaaacgccaaaacca
aatcatcgaacagctaaaggacttctttatccggcagctatttttctcttgctgtccctt
ctcttcggattgggtacagaatgggtgtcgccttacgttgatcaagcggccgagacgctg
ctgaatccggaaaaatatatcgaagctgttctgaaggagtag

DBGET integrated database retrieval system