KEGG   Bacillus subtilis subsp. subtilis 168: BSU31640
Entry
BSU31640          CDS       T00010                                 

Symbol
mrpE
Name
(RefSeq) Na(+)/H(+) antiporter subunit E
  KO
K05569  multicomponent Na+:H+ antiporter subunit E
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU31640 (mrpE)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU31640 (mrpE)
SSDB
Motif
Pfam: MNHE ATP-synt_I Wzy_C
Other DBs
NCBI-GeneID: 2914191
NCBI-ProteinID: YP_054591
Pasteur: BG14181
BSORF: BG14181
UniProt: Q7WY60 A0A6M4JNA4
Position
3251248..3251724
AA seq 158 aa
MAFQILLNVFLAFCWMFLSNSPSAAGFITGYILGMLSLFFFRRFFTRQFYLWKLISIIKL
CFIFIKELYLANVSVMKSVLSPKLNIRPGIFAFKTELTKDWEITMLSLLITLTPGTLVMD
ISDDRTILYIHAMDIEDAEKAIFDIRESFEKAIQEVSR
NT seq 477 nt   +upstreamnt  +downstreamnt
atggcatttcaaattttattaaatgtgtttctcgctttttgctggatgttcttaagcaac
agtccaagcgccgcaggattcattacaggctatattctgggaatgctctctctctttttc
ttccggcgctttttcactcgccagttttatctatggaaattgatttctattatcaagctc
tgtttcatttttataaaggaactgtaccttgccaatgtcagtgtgatgaaatcagtctta
tctccaaaactgaatatcagaccgggtatttttgcttttaaaactgaactgacgaaggac
tgggaaatcaccatgctttctctgctcattacattaacgccgggaaccttggtgatggat
atttcagatgacagaacaatactttatattcatgcaatggatatcgaggatgcggaaaaa
gcgatttttgacattcgggagtcatttgaaaaagccatacaggaggtgagccggtga

DBGET integrated database retrieval system