KEGG   Bacillus subtilis subsp. subtilis 168: BSU31650
Entry
BSU31650          CDS       T00010                                 

Gene name
mrpF
Definition
(RefSeq) Na(+)/H(+) antiporter subunit F
  KO
K05570  multicomponent Na+:H+ antiporter subunit F
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU31650 (mrpF)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU31650 (mrpF)
SSDB
Motif
Pfam: MrpF_PhaF Deltameth_res
Other DBs
NCBI-GeneID: 938862
NCBI-ProteinID: NP_391043
Pasteur: BG12344
BSORF: BG12344
UniProt: O05228 A0A6M4JLI4
Position
3251724..3252008
AA seq 94 aa
MFTLILQIALGIMAVSTFLYVIRVIKGPTVPDRVVALDAIGINLIAITALVSILLKTSAF
LDIILLLGILSFIGTIAFSKFLEKGEIIENDRNR
NT seq 285 nt   +upstreamnt  +downstreamnt
atgtttacgctgatcctgcaaatcgcgctcggcattatggcagtgtctacctttttgtat
gtcattcgtgtcattaaaggtccgactgtgcctgaccgggtcgtggctctggatgcaatc
ggcatcaatctgatcgcaatcacggcgcttgtctccattttgctgaaaacaagtgcgttt
ttggatattattttgttgctggggattttatcgtttatcggaacgatcgcattttccaag
ttcctggagaaaggagagattatcgaaaatgatcgaaaccgctaa

DBGET integrated database retrieval system