KEGG   Bacillus subtilis subsp. subtilis 168: BSU31660Help
Entry
BSU31660          CDS       T00010                                 

Gene name
mrpG
Definition
(RefSeq) Na(+)/H(+) antiporter subunit G
  KO
K05571  multicomponent Na+:H+ antiporter subunit G
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU31660 (mrpG)
Transporters [BR:bsu02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU31660 (mrpG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhaG_MnhG_YufB
Motif
Other DBs
NCBI-GeneID: 938864
NCBI-ProteinID: NP_391044
Pasteur: BG12343
BSORF: BG12343
UniProt: O05227
Position
3251992..3252366
Genome map
AA seq 124 aa AA seqDB search
MIETAKVVVAVFILLGALICLIASFGVLRLPDVFTRAHAASKGSTLGVNMILLGVFFYLW
FVTGELSAKILLGILFIFITSPIGGHLICRAAYNSGVKLDERSVQDDYNGIRNFVIKRKE
DSYL
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaaccgctaaggtcgttgtggctgtattcattttgctgggtgctcttatatgc
ctcattgcttcatttggcgtacttcgccttcccgatgtgtttacacgcgctcatgctgct
tctaaaggctcaacattaggtgtcaatatgattctgctcggtgtcttcttctatttgtgg
tttgtgacgggggagctctccgctaaaatcctgcttgggattctctttatctttattacg
tcgcctatcggcgggcacttgatctgccgtgctgcgtataactccggcgtcaagcttgat
gagagaagtgtgcaagatgactataacggaatcagaaactttgtgattaaacgaaaagag
gattcttatttataa

DBGET integrated database retrieval system