KEGG   Bacillus subtilis subsp. subtilis 168: BSU31670
Entry
BSU31670          CDS       T00010                                 

Gene name
yuxO
Definition
(RefSeq) esterase ComA2
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: 4HBT 4HBT_3 DUF4442 Thiopep_pre
Other DBs
NCBI-GeneID: 937178
NCBI-ProteinID: NP_391045
Pasteur: BG10382
BSORF: BG10382
UniProt: P14205 A0A6M4JNV1
Position
complement(3252405..3252785)
AA seq 126 aa
MDMKHTLLEALGIEIVENTAERCVAVMPVDHRTVQPFGYLHGGASVALAETAASAGAQNL
IDHTTQACVGLEINANHLKSVKEGTVKAIAEPVHIGRTTIVYHIHIYDEQERLICISRCT
LAVIKK
NT seq 381 nt   +upstreamnt  +downstreamnt
atggatatgaagcacacattgcttgaagcgcttggtattgagattgttgaaaacacagcg
gaacgatgcgttgcggtcatgccggtggatcatcggacggtacagccgttcggatatttg
catggaggcgcttcagtggccctggcggaaaccgcggcgagcgcaggtgcacagaacctg
attgatcatacaacgcaagcttgtgttggtttggagattaacgccaaccatttaaaatct
gtaaaggaaggaacggtaaaggcgatagccgagcccgttcatataggcagaacgacgatt
gtctatcatattcacatatatgacgagcaagagaggctgatctgtatatccagatgcacg
ctggctgtcatcaagaaataa

DBGET integrated database retrieval system