KEGG   Bacillus subtilis subsp. subtilis 168: BSU31680Help
Entry
BSU31680          CDS       T00010                                 

Gene name
comA
Definition
(RefSeq) transcriptional regulatory protein ComA
  KO
K07691  two-component system, NarL family, competent response regulator ComA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
bsu02024  Quorum sensing
Module
bsu_M00476  ComP-ComA (competence) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU31680 (comA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU31680 (comA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU31680 (comA)
Two-component system [BR:bsu02022]
 NarL family
  ComP-ComA [MD:M00476]
   BSU31680 (comA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg GerE HTH_23 Sigma70_r4_2 Sigma70_ECF ARL2_Bind_BART Sigma70_r4
Motif
Other DBs
NCBI-GeneID: 937179
NCBI-ProteinID: NP_391046
Pasteur: BG10381
BSORF: BG10381
UniProt: P14204
Structure
PDB: 

Position
complement(3252804..3253448)
Genome map
AA seq 214 aa AA seqDB search
MKKILVIDDHPAVMEGTKTILETDSNLSVDCLSPEPSEQFIKQHDFSSYDLILMDLNLGG
EVNGMELSKQILQENPHCKIIVYTGYEVEDYFEEAIRAGLHGAISKTESKEKITQYIYHV
LNGEILVDFAYFKQLMTQQKTKPAPSSQKEQDVLTPRECLILQEVEKGFTNQEIADALHL
SKRSIEYSLTSIFNKLNVGSRTEAVLIAKSDGVL
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatactagtgattgatgaccatccggctgtcatggaaggcaccaagacaatt
ttggaaacggattcgaatttgtctgttgattgtctcagtcctgaaccgagcgaacagttt
atcaagcagcatgatttctcgtcatatgatctcattttaatggatctgaatctaggcggc
gaggtcaatgggatggagctttctaaacagattttacaagagaatcctcattgtaaaatt
atcgtgtataccggttatgaggtcgaggattatttcgaggaagcgattcgtgcgggtctg
cacggtgccatcagcaaaacggaatctaaagaaaagatcacccaatacatataccacgta
ctcaacggagaaattttagtcgattttgcttactttaaacagctgatgactcagcaaaaa
acaaagccggctccttcctctcaaaaagaacaagatgtgctcacacctagagaatgcctg
attcttcaagaagttgaaaagggatttacaaaccaagaaatcgcagatgcccttcattta
agcaagcggtccattgaatacagcttgacatcgattttcaataagctgaatgtcggttca
cggacggaagcggttttgattgcgaaatcagacggtgtactttaa

DBGET integrated database retrieval system