KEGG   Bacillus subtilis subsp. subtilis 168: BSU31690Help
Entry
BSU31690          CDS       T00010                                 

Gene name
comP
Definition
(RefSeq) sensor histidine kinase
  KO
K07680  two-component system, NarL family, sensor histidine kinase ComP [EC:2.7.13.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
bsu02024  Quorum sensing
Module
bsu_M00476  ComP-ComA (competence) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU31690 (comP)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU31690 (comP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bsu01001]
    BSU31690 (comP)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU31690 (comP)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     BSU31690 (comP)
Protein kinases [BR:bsu01001]
 Histidine kinases
  NarL family
   BSU31690 (comP)
Two-component system [BR:bsu02022]
 NarL family
  ComP-ComA [MD:M00476]
   BSU31690 (comP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HisKA_3 HATPase_c PDZ PDZ_6 HATPase_c_5 HATPase_c_2 PDZ_2
Motif
Other DBs
NCBI-GeneID: 938866
NCBI-ProteinID: NP_391047
Pasteur: BG10380
BSORF: BG10380
UniProt: Q99027
Position
complement(3253529..3255838)
Genome map
AA seq 769 aa AA seqDB search
MKNLIKKFTIAVIVLSILYISYTTYISMNGIIIGTKIHKNDKSQFMIEEISESSYGQFVG
LRQGDIILKINKEKPSDKHLKWGYLSHINSLDILRSGKKIHLKDFDLVTLNRPYSFFLFV
LPLFFYFLSIICIFYILKVNKKRRSFAAYILILLLLDISIAYISAGGPFRGHIINRYINL
FTFISSPILYLQFIQRYLGEIGKTFLNRISFLYIIPIFNLGIEFFQDYLQVDIDFLATLN
LVSFATLTLFSFSAIYLHLNKYKYAEHSFILKLLILTNTLSFAPFLIFFVLPIIFTGNYI
FPALASASLLVLIPFGLVYQFVANKMFDIEFILGRMRYYALLAMIPTLLIVGALVLFDVM
DIQMNPVRQTVFFFVVMFAVFYFKEVMDFKFRLKRFSEKFNYQDSIFKYTQLMRGVTSLQ
QVFKELKNTILDVLLVSKAYTFEVTPDHKVIFLDKHEVGPDWNFYQEEFENVTSEIGKII
EVNQGFLMKVGERGGSSYVLLCLSNINTPRLTRDEISWLKTLSFYTSVSMENVLHIEELM
EHLKDLKQEGTNPIWLKKLMFAIEEKQRSGLARDLHDSVLQDLISLKRQCELFLGDFKKD
DNPCREEVQDKLVQMNEQMSDVISMTRETCHELRPQLLYDLGLVKALSKLVAQQQERVPF
HIRLNTGRFTASLDLDSQLNLYRIIQEFLSNAVKHSQATDVLIMLISIQNKIVLHYEDDG
VGFDQEKNTEHSMSMGLSGIKERVRALDGRLRIETSEGKGFKADIEIEL
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaacttaataaaaaaattcacaatagctgtaattgttttgagtatcctttatata
agctatacaacttatatcagtatgaatggaattattattgggactaagattcataaaaat
gataaaagtcaatttatgatagaagaaatatcggaatcttcatatggacaatttgttggt
ctgagacagggagacatcatattaaaaattaataaagaaaaaccttcagacaaacatttg
aaatggggatatttgagtcatattaacagtctggatattttgagaagtggaaaaaagatt
catctcaaagattttgatttagttactctaaatagaccttatagtttttttctgttcgta
cttcctttgtttttttattttttaagcataatatgtattttttatatacttaaagtaaat
aaaaaaaggagatcatttgctgcctatattcttattctattgttattagacatttcgata
gcatatataagtgcaggcggaccatttagaggacatataatcaatcggtatattaacttg
tttacttttatatcttctcctattctttatcttcaatttatacaaagataccttggagaa
ataggtaaaacttttttgaatagaatttcttttctttatatcataccaatatttaatctt
ggtattgagttttttcaagactatttacaagtagatattgattttttagcaactcttaat
ttggtttcttttgcaactttgactctattttctttttcagcgatatacttacatcttaat
aaatataaatatgctgagcattcgtttattcttaaattactaattttaacaaacactctt
tcatttgcgccttttttgatattttttgttcttccaataatatttacaggtaattatatt
ttcccggcattagcttcggcgtcattactagtactaattccgttcgggttagtataccaa
tttgtagccaataagatgtttgatatagagtttatcttaggaagaatgagatactatgct
ctacttgccatgataccaactcttctaatagttggtgcattagttctgtttgatgtaatg
gacatccagatgaaccctgtgcgtcaaactgtattttttttcgttgtcatgttcgctgtc
ttttattttaaagaggtcatggattttaaatttcggttaaaacgtttctccgaaaaattc
aactatcaggacagtatttttaaatatactcagctaatgaggggtgtaacttctcttcaa
caagtttttaaagaactgaaaaatactatactggatgttttgcttgtaagcaaagcttat
acctttgaggttactcctgatcacaaagtgatatttttagataagcatgaagttggaccg
gactggaatttttatcaagaggaatttgaaaacgtaacttcagaaattgggaaaattata
gaagtcaatcaaggctttcttatgaaagttggtgaacgaggcggtagttcttatgttctg
ctttgtttatctaatattaacactccccggctaacacgtgatgaaatatcgtggctgaaa
acactgtctttttatacaagtgtgtccatggaaaatgtcctgcatattgaggagctcatg
gaacatttgaaggacttaaaacaagagggaaccaaccccatctggctgaaaaagctaatg
tttgcaatcgaagaaaaacagcgttcaggactcgcccgcgatctccacgattcggttctt
caggatttgatttccttaaaacgccagtgtgagctgtttttgggtgatttcaagaaggat
gataatccgtgccgtgaagaggtgcaggacaagcttgtacagatgaatgagcagatgtct
gatgtgatttcgatgacgagggagacgtgtcatgagctgcggccgcagcttctgtatgat
cttggattggtgaaggcgctgtcgaagctggtggcgcagcagcaggagcgggttccgttt
catatccgtttaaataccgggagatttacggcttcccttgatctggattcgcagctgaat
ttgtaccggatcattcaagagtttctgtctaatgcggtcaagcactctcaggcgacggat
gtgctgattatgctcatcagtattcaaaacaaaatcgttcttcattatgaggacgatggc
gttgggtttgatcaagaaaaaaatactgagcattccatgagcatggggctttctggcatt
aaggagagagtcagggctttagatgggcgccttcggattgaaacaagtgaaggaaagggc
tttaaggctgatattgaaatcgaattgtaa

DBGET integrated database retrieval system