KEGG   Bacillus subtilis subsp. subtilis 168: BSU31700Help
Entry
BSU31700          CDS       T00010                                 

Gene name
comX
Definition
(RefSeq) competence pheromone
  KO
K02253  competence protein ComX
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
bsu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU31700 (comX)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU31700 (comX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bsu02044]
    BSU31700 (comX)
Secretion system [BR:bsu02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) related proteins
   BSU31700 (comX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ComX Methyltransf_33 NADH_dhqG_C
Motif
Other DBs
NCBI-GeneID: 938875
NCBI-ProteinID: NP_391048
Pasteur: BG11324
BSORF: BG11324
UniProt: P45453
Position
complement(3255853..3256020)
Genome map
AA seq 55 aa AA seqDB search
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD
NT seq 168 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacctaattaactactttttaaattatcctgaggctttaaaaaaattgaaaaat
aaagaagcctgccttataggttttgatgtgcaagaaactgaaacaataattaaagcttat
aatgattattatctggctgatccaataacccgtcaatggggtgattaa

DBGET integrated database retrieval system