KEGG   Bacillus subtilis subsp. subtilis 168: BSU31710Help
Entry
BSU31710          CDS       T00010                                 

Gene name
comQ
Definition
(RefSeq) competence regulatory protein ComQ
  KO
K02251  competence protein ComQ
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU31710 (comQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bsu02044]
    BSU31710 (comQ)
Secretion system [BR:bsu02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) related proteins
   BSU31710 (comQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-GeneID: 937180
NCBI-ProteinID: NP_391049
Pasteur: BG10379
BSORF: BG10379
UniProt: P33690
Position
complement(3256008..3256907)
Genome map
AA seq 299 aa AA seqDB search
MKEIVEQNIFNEDLSQLLYSFIDSKETFSFAESTILHYVVFGGENLDVATRLGAGIEILI
LSSDIMDDLEDEDNHHALWMKINRSESLNAALSLYTVGLTSIYSLNNNPLIFKYVLKYVN
EAMQGQHDDITNKSKTEDESLEVIRLKCGSLIALANVAGVLLATGEYNETVERYSYYKGI
IAQISGDYYVLLSGNRSDIEKNKHTLIYLYLKRLFNDASEDLLYLISHKDLYYKSLLDKE
KFQEKLIKAGVTQYISVLLEIYKQKCISAIEQLNLDKEKKELIKECLLSYTKGDTRCKT
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagattgtggagcaaaacatatttaacgaggatttgtcacaacttctttactca
tttattgattctaaagaaacattctcctttgctgaatccacaatcttacattatgttgtt
tttggaggggagaatttagatgttgcaacaaggcttggcgcgggaatagaaattcttatt
ctttcatcagatattatggatgatcttgaagatgaagataatcaccatgcattatggatg
aaaattaatcgctcggagtcgttaaatgcagcactttccttgtatacagtaggattaacg
agtatttattcattaaataacaatcctctaatttttaaatatgttttaaaatacgtaaac
gaggccatgcaaggtcaacatgacgatatcactaataaatctaaaacagaagatgaaagt
ttagaagtaattagattaaaatgtggaagtctgattgcactagcaaatgtagcaggtgtt
ttattggctacaggagaatataatgaaacagttgaaagatattcctactataaagggatt
atagctcaaatttctggagattattatgttcttttatccggaaatcgcagtgatattgaa
aaaaacaaacatacactgatttacttatatcttaagcgcctttttaatgatgcttcggaa
gatttattatacttaatttcacataaagacttatattataaatcgttacttgataaagag
aaattccaagaaaaattaattaaagcgggagttactcaatacatttcggtattattggaa
atatataaacagaaatgtatttctgctatagaacaattaaatttagataaagaaaaaaaa
gagctaataaaggaatgcttattaagttatacaaagggggatacaagatgcaagacctaa

DBGET integrated database retrieval system