KEGG   Bacillus subtilis subsp. subtilis 168: BSU31720Help
Entry
BSU31720          CDS       T00010                                 

Gene name
degQ
Definition
(RefSeq) degradation enzyme regulation protein DegQ
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DegQ Swi5 XhlA
Motif
Other DBs
NCBI-GeneID: 936547
NCBI-ProteinID: NP_391050
Pasteur: BG10378
BSORF: BG10378
UniProt: Q99039
Position
complement(3257092..3257232)
Genome map
AA seq 46 aa AA seqDB search
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS
NT seq 141 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaaacttgaagaagtaaaacaattgttattccgactcgaacttgatattaaa
gaaacgacagattcattacgaaacattaacaaaagcattgatcaactcgataaatacaat
tatgcaatgaaaatttcgtga

DBGET integrated database retrieval system