KEGG   Bacillus subtilis subsp. subtilis 168: BSU31730Help
Entry
BSU31730          CDS       T00010                                 

Gene name
yuzC
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 938859
NCBI-ProteinID: NP_391051
Pasteur: BG14052
BSORF: BG14052
UniProt: O32089
Position
3257693..3258061
Genome map
AA seq 122 aa AA seqDB search
MRYRYPWFYVYPYEVRRPPAPANNIDTFIRSAKQAAGIFADAQLVLSRIAGSRELSRRIL
TAAEQSDKQTIRRLIKQMGVRHEVDTVFNPDGIYISLIGTQSRMILALRWSEDRNHFASI
RL
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgagatatcgttatccctggttttacgtgtatccgtatgaggtacgccgtccgcccgct
cctgccaacaatattgatacctttatccgttcagcgaagcaggccgcagggatatttgcg
gatgcccagctcgttctcagccgcattgcgggctcgcgggagctttcgcgccgcattctg
accgcagccgaacagtctgataaacaaactataaggcgcctgatcaaacaaatgggcgtc
cggcatgaagtggatacggtctttaatcccgacggcatctatatcagccttatcggaacg
caaagccgaatgattcttgctttgcggtggtcagaggaccgcaatcattttgcgtccata
agattatga

DBGET integrated database retrieval system