KEGG   Bacillus subtilis subsp. subtilis 168: BSU31730
Entry
BSU31730          CDS       T00010                                 

Gene name
yuzC
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 938859
NCBI-ProteinID: NP_391051
Pasteur: BG14052
BSORF: BG14052
UniProt: O32089 A0A6M3ZGB1
Position
3257693..3258061
AA seq 122 aa
MRYRYPWFYVYPYEVRRPPAPANNIDTFIRSAKQAAGIFADAQLVLSRIAGSRELSRRIL
TAAEQSDKQTIRRLIKQMGVRHEVDTVFNPDGIYISLIGTQSRMILALRWSEDRNHFASI
RL
NT seq 369 nt   +upstreamnt  +downstreamnt
atgagatatcgttatccctggttttacgtgtatccgtatgaggtacgccgtccgcccgct
cctgccaacaatattgatacctttatccgttcagcgaagcaggccgcagggatatttgcg
gatgcccagctcgttctcagccgcattgcgggctcgcgggagctttcgcgccgcattctg
accgcagccgaacagtctgataaacaaactataaggcgcctgatcaaacaaatgggcgtc
cggcatgaagtggatacggtctttaatcccgacggcatctatatcagccttatcggaacg
caaagccgaatgattcttgctttgcggtggtcagaggaccgcaatcattttgcgtccata
agattatga

DBGET integrated database retrieval system