KEGG   Bacillus subtilis subsp. subtilis 168: BSU31740
Entry
BSU31740          CDS       T00010                                 

Gene name
pdeH
Definition
(RefSeq) phosphodiesterase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HDOD EAL
Other DBs
NCBI-GeneID: 937185
NCBI-ProteinID: NP_391052
Pasteur: BG10377
BSORF: BG10377
UniProt: P14203 A0A6M4JLJ5
Position
complement(3258037..3259266)
AA seq 409 aa
MRVFVARQPIFNRKEQVVAYELLYRESEENVYSAKDGDQATTDLVINSFLNIGIEKLTEG
KRCFVNFTESLMFSNLPTSFNPKQLVIEILEDIPITPALISRCKELKKMGYMLALDDFYA
INPQDEDLLEKLMSYIDILKIDFLKTTRMERRTILQTYGCRGLIFLAEKVETRKEYKQAV
QDGFQLFQGYFFSEPRIISGHDLSTHFYSYYELLNELSKEQPNIKRVTEYIERDLSLSYQ
ILKFLNSSHSRLSQKIESIQQAIMLLGFNEIKRWIYILSFKDLSRKGHSSKHEIIKISLI
RAKLCELLARKTSRPQPASYMLIGMFSLIDTLLHREIEEIVQELPLKDEVGQALLGHQND
YYQMLELVKLIESNNWDTCSELGNQLDKEEAYECYLEALEWCHNLMDAK
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgagggtgtttgttgcaagacagcctatttttaatagaaaagaacaggttgttgcttat
gaactgctgtatagagaaagcgaagagaacgtgtatagcgctaaagacggcgatcaggca
acaacagatttggtgatcaacagctttttaaacatcggaattgagaagctgacggaaggg
aaacgctgttttgttaattttacggaaagcctgatgttttcgaatcttcccacctccttc
aatccgaaacagcttgtcattgaaatccttgaagatataccgatcacgccggccctcatt
tctagatgcaaagaattgaaaaaaatggggtatatgctggcgcttgatgatttttatgca
ataaatccgcaagatgaggacttactggaaaaactcatgagctatattgatatattgaaa
attgattttctcaaaacaacacgaatggaacgcagaacaattttgcaaacctacggctgc
cgcggcctgatttttttagcggaaaaagtagagacccgaaaagaatataaacaggcggtc
caagacggctttcaattattccaaggctactttttcagcgagccgcgcatcatcagcggg
catgacctatcgactcatttctattcttactatgaactgcttaacgaactgagtaaagag
cagcctaacataaagcgtgtgacagagtacatagagcgggatttatcactgtcctatcaa
attttaaaatttttaaactcatcccacagccgtttgagccagaaaattgaaagcattcaa
caggccattatgctgctgggatttaatgaaatcaaacggtggatatatattctttccttt
aaggatttaagcaggaaagggcattccagcaagcacgaaatcattaagatttctctgata
agagcaaagctttgcgaactgctggcgagaaagacatcccggccgcagcctgcttcttat
atgctgatcggaatgttttctctcatagacaccctcctgcatagagaaatagaggaaatt
gttcaagaattgcctttaaaagatgaagtcgggcaagcattattaggccatcaaaacgac
tactaccaaatgcttgagcttgtgaaattaattgaaagcaacaactgggacacttgctca
gaattaggcaatcaactggacaaagaagaagcgtatgaatgttatttagaggctctggaa
tggtgtcataatcttatggacgcaaaatga

DBGET integrated database retrieval system