KEGG   Bacillus subtilis subsp. subtilis 168: BSU31750Help
Entry
BSU31750          CDS       T00010                                 

Gene name
yueK
Definition
(RefSeq) nicotinate phosphoribosyltransferase
  KO
K00763  nicotinate phosphoribosyltransferase [EC:6.3.4.21]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00760  Nicotinate and nicotinamide metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BSU31750 (yueK)
Enzymes [BR:bsu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.21  nicotinate phosphoribosyltransferase
     BSU31750 (yueK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAPRTase_N NAPRTase_C NAPRTase Glyco_hydro_59 QRPTase_N OAM_dimer
Motif
Other DBs
NCBI-GeneID: 937186
NCBI-ProteinID: NP_391053
Pasteur: BG13966
BSORF: BG13966
UniProt: O32090
Position
complement(3259403..3260875)
Genome map
AA seq 490 aa AA seqDB search
MLEYGFKDDSLSLHTDLYQINMAETYWRDGIHEKKAIFELFFRRLPFENGYAVFAGLEKA
IEYLENFKFTDSDLSYLQDELGYHEDFIEYLRGLSFTGSLYSMKEGELVFNNEPIMRVEA
PLVEAQLIETALLNIVNYQTLIATKAARIKGVIGDEVALEFGTRRAHEMDAAMWGARAAL
IGGFSATSNVRAGKRFNIPVSGTHAHALVQAYRDEYTAFKKYAETHKDCVFLVDTYDTLR
SGMPNAIRVAKEFGDRINFIGIRLDSGDLAYLSKKARKMLDEAGFTDAKVIASSDLDEHT
IMNLKAQGARIDVWGVGTKLITAYDQPALGAVYKLVAIEEDGKMVDTIKISSNPEKVTTP
GRKKVYRIINQSNHHSEGDYIALYDEQVNDQKRLRMFHPVHTFISKFVTNFYAKDLHELI
FEKGILCYQNPEISDIQQYVQDNLSLLWEEYKRISKPEEYPVDLSEDCWSNKMQRIHEVK
SRIEEELEEE
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
gtgttagagtacggatttaaagatgacagcctgtcattacatacagacctttatcagatc
aatatggcggaaacgtactggagagacggcattcatgaaaagaaagcgatttttgagctg
tttttcagaaggcttccgtttgaaaatggctatgccgtatttgcgggcttggaaaaagcc
attgaatacttggaaaatttcaagtttacggatagcgatttgagttatttacaggatgaa
ctcgggtatcatgaagattttattgaatatttgcgcggcttatcttttacaggttcactt
tactccatgaaagaaggagaactcgtttttaacaatgagccgattatgagggtggaggca
cccctggtagaagcgcagctgattgaaacagctttgctcaacattgtgaactatcaaaca
ttaatcgcaacaaaggctgcccggattaaaggcgtcatcggtgatgaagttgcgcttgaa
ttcggaacaagacgggcgcacgaaatggatgcggccatgtggggagcgagagcagcctta
atcggcggctttagcgcgacaagcaatgtaagagccggaaagcgctttaatatcccggtt
tccggcacacatgcgcatgcgcttgtgcaggcttaccgcgatgaatatacagctttcaaa
aaatacgcggaaacacataaggattgcgtcttcttagttgacacgtatgacacgcttcgt
tcaggcatgccgaacgcgattagggttgccaaggaattcggcgaccgcattaatttcatt
ggcatccgtctggacagcggcgatttggcgtacctgtcaaaaaaagcccggaaaatgctt
gatgaagcaggatttacagatgcgaaggtgattgcttcaagcgatttggatgagcacacc
attatgaatttaaaggctcagggagcgcgcattgatgtctggggtgtcggtacgaagctg
atcactgcctatgaccagccggctctcggcgcagtttataaactcgttgccattgaagaa
gacgggaaaatggtcgacacgatcaaaatttcgtccaatcctgaaaaagtgacgacaccg
ggcagaaagaaagtctaccgcattattaatcagtccaaccatcattctgaaggcgactat
attgcgctttatgatgagcaggtgaatgatcagaagcggctcagaatgttccacccggtt
catacattcatcagcaaatttgtcacgaatttttatgcgaaggatcttcatgaactgatt
tttgagaagggtattctttgctaccaaaaccctgagatttcagacatacagcagtatgtg
caggataacctcagcctgctttgggaggaatataagagaatcagcaagccggaggaatac
ccggttgatttaagcgaggactgctggagcaataaaatgcagcggatccacgaagtgaaa
agcagaattgaagaagagcttgaggaagaataa

DBGET integrated database retrieval system