KEGG   Bacillus subtilis subsp. subtilis 168: BSU31760Help
Entry
BSU31760          CDS       T00010                                 

Gene name
pncA
Definition
(RefSeq) isochorismatase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Isochorismatase
Motif
Other DBs
NCBI-GeneID: 938863
NCBI-ProteinID: NP_391054
Pasteur: BG13965
BSORF: BG13965
UniProt: O32091
Position
complement(3260891..3261442)
Genome map
AA seq 183 aa AA seqDB search
MKKALICIDYTNDFVASDGKLTCGEPGRMIEEAIVNLTKEFITNGDYVVLAVDSHDEGDQ
YHPETRLFPPHNIKGTEGKDLYGKLLPLYQKHEHEPNVYYMEKTRYSAFAGTDLELKLRE
RQIGELHLAGVCTDICVLHTAVDAYNKGFRIVVHKQAVASFNQEGHAWALSHFANSIGAQ
VAE
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagcacttatttgtattgattatacgaatgattttgtggcgagtgacggaaaa
ttgacctgcggggagcccggcagaatgattgaagaggcgatcgtcaatttaactaaagaa
ttcatcacaaacggtgattacgtcgtattagcagtagattctcatgatgaaggggatcaa
tatcaccctgaaacccgtctttttcctccgcataatataaaaggcacggaaggaaaagat
ctgtacggaaagcttttgcctctatatcagaaacatgaacatgaacctaatgtttactac
atggaaaaaacgagatattctgcttttgcgggaactgatttagagctcaaactcagagag
cggcagattggcgaactgcatcttgccggtgtctgcacagatatttgtgtgttgcataca
gctgttgacgcatacaacaaaggttttcggattgttgtgcataaacaagctgttgccagc
tttaatcaggaggggcacgcatgggctctttcccattttgcaaacagcatcggagcgcaa
gtggcagagtaa

DBGET integrated database retrieval system