KEGG   Bacillus subtilis subsp. subtilis 168: BSU31770Help
Entry
BSU31770          CDS       T00010                                 

Gene name
yueI
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1694
Motif
Other DBs
NCBI-GeneID: 938125
NCBI-ProteinID: NP_391055
Pasteur: BG13964
BSORF: BG13964
UniProt: O32092
Structure
PDB: 

Position
complement(3261539..3261937)
Genome map
AA seq 132 aa AA seqDB search
MSEDKMDLYLQQGMYGPLETKPDERHLFLGSLRERVVLALTKGQVLRSKPYKEAEHELKN
SHNVTLLINGELQYQSYSSYIQMASRYGVPFKIVSDLQFHTPLGIVIAADIAVNRELIYI
QDDIYNRSVLKS
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
ttgagtgaagataaaatggatctctatttgcagcaaggaatgtatgggcctttggagaca
aagcctgacgagcgccatttgtttttaggctctttaagagaaagagtcgttttggcactg
acgaaaggacaggtgcttagaagcaaaccgtataaagaggcagagcacgagctgaaaaac
agccataacgtcacccttttgattaatggagagcttcagtatcagtcttactcttcttat
atccaaatggcgagccggtacggagtgcctttcaagattgtatctgatctccagtttcat
acgcccttaggcatcgtcattgcggctgatatcgctgtgaatcgtgaattgatatatatt
caggacgacatttataatcggtcagtactgaaatcgtaa

DBGET integrated database retrieval system