KEGG   Bacillus subtilis subsp. subtilis 168: BSU31780
Entry
BSU31780          CDS       T00010                                 

Gene name
yueH
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YueH DUF6340
Other DBs
NCBI-GeneID: 936537
NCBI-ProteinID: NP_391056
Pasteur: BG13963
BSORF: BG13963
UniProt: O32093 A0A6M4JLR0
Position
complement(3262009..3262257)
AA seq 82 aa
MKIRKANINTQTGMITDVYLHENRKELRTLVAVPQLEWSTIISYEEDKATLPERLEASLR
RHTEETPAGELAKKIIHWVTEM
NT seq 249 nt   +upstreamnt  +downstreamnt
atgaaaatcagaaaagcaaatatcaatacgcaaaccggaatgatcacggacgtgtatctg
catgaaaacagaaaagaactgcgcacgcttgtagcggtaccgcagctggagtggagcacg
atcatttcctatgaagaagataaagcaactctgcctgaacggctggaagcgtcgttgcgc
cggcatacagaggaaacccctgctggtgagctggccaaaaaaatcattcattgggtaaca
gaaatgtaa

DBGET integrated database retrieval system