KEGG   Bacillus subtilis subsp. subtilis 168: BSU31790
Entry
BSU31790          CDS       T00010                                 

Symbol
yueG
Name
(RefSeq) spore germination protein-like protein YueG
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: gerPA
Other DBs
NCBI-GeneID: 936561
NCBI-ProteinID: NP_391057
Pasteur: BG13962
BSORF: BG13962
UniProt: O32094 A0A6M3ZFV1
Position
complement(3262330..3262551)
AA seq 73 aa
MPAIVGPIYIMSVTDNAAASFGDVFAISPKSVAHSGAGSGTFQLGDFVKINNQTSKTLFK
DADITDETVSFNG
NT seq 222 nt   +upstreamnt  +downstreamnt
atgcctgcaattgtggggccgatttatatcatgtcagttacggataatgccgcggcaagc
tttggagacgtatttgcgatttcgcccaaaagcgtcgctcattcaggggcggggtcaggc
acatttcagcttggtgattttgtgaagattaacaaccaaacgagtaaaactctcttcaaa
gatgccgatatcactgatgaaacagtttcgtttaacgggtaa

DBGET integrated database retrieval system