KEGG   Bacillus subtilis subsp. subtilis 168: BSU31790Help
Entry
BSU31790          CDS       T00010                                 

Gene name
yueG
Definition
(RefSeq) spore germination protein-like protein YueG
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: gerPA
Motif
Other DBs
NCBI-GeneID: 936561
NCBI-ProteinID: NP_391057
Pasteur: BG13962
BSORF: BG13962
UniProt: O32094
Position
complement(3262330..3262551)
Genome map
AA seq 73 aa AA seqDB search
MPAIVGPIYIMSVTDNAAASFGDVFAISPKSVAHSGAGSGTFQLGDFVKINNQTSKTLFK
DADITDETVSFNG
NT seq 222 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcaattgtggggccgatttatatcatgtcagttacggataatgccgcggcaagc
tttggagacgtatttgcgatttcgcccaaaagcgtcgctcattcaggggcggggtcaggc
acatttcagcttggtgattttgtgaagattaacaaccaaacgagtaaaactctcttcaaa
gatgccgatatcactgatgaaacagtttcgtttaacgggtaa

DBGET integrated database retrieval system