KEGG   Bacillus subtilis subsp. subtilis 168: BSU31810Help
Entry
BSU31810          CDS       T00010                                 

Gene name
yuzE
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2283
Motif
Other DBs
NCBI-GeneID: 937187
NCBI-ProteinID: NP_391059
Pasteur: BG14054
BSORF: BG14054
UniProt: O32096
Position
3263835..3264224
Genome map
AA seq 129 aa AA seqDB search
MKAVTYDTDSELAYIYVLPPKKNRNVRTEELRVNDCLLLDISQDGKIAGFECFGEAAHLC
APFAGKSRLYVKDSDGYHFRVCQHASVRSCYTVYRVTFCFSDGDYQEFAGFDLDGTMYHS
AFLQRLTEK
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgtgacatacgatacagattcagaactggcttatatctatgttcttcctccg
aaaaagaacaggaatgtacggactgaggagctcagagtcaatgattgtctcctgctggat
atcagccaagatggcaaaatcgccggattcgaatgttttggtgaggcagcacacctctgt
gccccatttgccgggaaatcccggctgtatgtaaaagattcagacggttatcattttcgg
gtctgccagcatgcttcagtccgttcctgctatacggtgtaccgtgtcactttctgtttt
tcagatggtgactatcaggaatttgccggctttgaccttgatggaacaatgtatcatagt
gcgtttttacagcgcttaactgaaaaatag

DBGET integrated database retrieval system