KEGG   Bacillus subtilis subsp. subtilis 168: BSU31810
Entry
BSU31810          CDS       T00010                                 

Gene name
yuzE
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2283
Other DBs
NCBI-GeneID: 937187
NCBI-ProteinID: NP_391059
Pasteur: BG14054
BSORF: BG14054
UniProt: O32096 A0A6M3ZG50
Position
3263835..3264224
AA seq 129 aa
MKAVTYDTDSELAYIYVLPPKKNRNVRTEELRVNDCLLLDISQDGKIAGFECFGEAAHLC
APFAGKSRLYVKDSDGYHFRVCQHASVRSCYTVYRVTFCFSDGDYQEFAGFDLDGTMYHS
AFLQRLTEK
NT seq 390 nt   +upstreamnt  +downstreamnt
atgaaggccgtgacatacgatacagattcagaactggcttatatctatgttcttcctccg
aaaaagaacaggaatgtacggactgaggagctcagagtcaatgattgtctcctgctggat
atcagccaagatggcaaaatcgccggattcgaatgttttggtgaggcagcacacctctgt
gccccatttgccgggaaatcccggctgtatgtaaaagattcagacggttatcattttcgg
gtctgccagcatgcttcagtccgttcctgctatacggtgtaccgtgtcactttctgtttt
tcagatggtgactatcaggaatttgccggctttgaccttgatggaacaatgtatcatagt
gcgtttttacagcgcttaactgaaaaatag

DBGET integrated database retrieval system