KEGG   Bacillus subtilis subsp. subtilis 168: BSU31820Help
Entry
BSU31820          CDS       T00010                                 

Gene name
yuzF
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2642
Motif
Other DBs
NCBI-GeneID: 936562
NCBI-ProteinID: NP_391060
Pasteur: BG14055
BSORF: BG14055
UniProt: O32097
Position
complement(3264265..3264501)
Genome map
AA seq 78 aa AA seqDB search
MVNQGSPQLVSLVDPYVYQTIKKLIGSRFVIQTVRDTVRGRLIDVKPDHITIEGARNSVC
LIRIQHMISVTPDYSERV
NT seq 237 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaccaaggtagtccgcaactggtctctttagtcgatccttatgtctatcagacc
attaaaaagctcatcggctcaaggttcgttatacagacagtacgagatacggtcagaggc
agactgatcgatgtaaaacctgaccatatcacaattgaaggagcccgaaattctgtttgt
ttgatcagaatccagcacatgatttccgtcaccccagattacagtgagcgggtctaa

DBGET integrated database retrieval system