KEGG   Bacillus subtilis subsp. subtilis 168: BSU31820
Entry
BSU31820          CDS       T00010                                 

Gene name
yuzF
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2642
Other DBs
NCBI-GeneID: 936562
NCBI-ProteinID: NP_391060
Pasteur: BG14055
BSORF: BG14055
UniProt: O32097 A0A6M4JMI4
Position
complement(3264265..3264501)
AA seq 78 aa
MVNQGSPQLVSLVDPYVYQTIKKLIGSRFVIQTVRDTVRGRLIDVKPDHITIEGARNSVC
LIRIQHMISVTPDYSERV
NT seq 237 nt   +upstreamnt  +downstreamnt
atggtcaaccaaggtagtccgcaactggtctctttagtcgatccttatgtctatcagacc
attaaaaagctcatcggctcaaggttcgttatacagacagtacgagatacggtcagaggc
agactgatcgatgtaaaacctgaccatatcacaattgaaggagcccgaaattctgtttgt
ttgatcagaatccagcacatgatttccgtcaccccagattacagtgagcgggtctaa

DBGET integrated database retrieval system