KEGG   Bacillus subtilis subsp. subtilis 168: BSU31830Help
Entry
BSU31830          CDS       T00010                                 

Gene name
yueE
Definition
(RefSeq) phosphohydrolase YueE
  KO
K06950  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU31830 (yueE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HD HDOD
Motif
Other DBs
NCBI-GeneID: 936545
NCBI-ProteinID: NP_391061
Pasteur: BG13960
BSORF: BG13960
UniProt: O32098
Position
complement(3264678..3265208)
Genome map
AA seq 176 aa AA seqDB search
MRKVTLMDVFTHPIAQKYLQRSGVAHAIACAYHAYRLSVKADINPDLAAKAALLHDIGHY
EWYTDGKWDYEKYKRNDIHAIKGAERAHKLLIRLGEEPKAAKEIALAILLHTDSYLPEGE
LDKNTLQQIVKKADELDEEPGGHHHYRQIDPSTARKKIEKLDQLIDQAQASVIKPV
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaggttacattaatggatgttttcacccatccaattgcacaaaaatatcttcag
cgttccggcgtggcacatgcgattgcctgcgcttatcatgcatacaggctgtctgtgaag
gctgacattaatcctgatttagcagcaaaagcggcactgcttcatgacattggccattat
gaatggtatacagacggaaagtgggattatgagaaatacaaaagaaatgacattcatgcc
attaaaggggcggaacgggcgcataaacttctgattcggcttggcgaggaaccgaaagca
gcaaaagagattgcactagccattttgcttcatacagattcctatttgcctgaaggcgaa
ttagataaaaacacactgcagcagattgtcaaaaaagcggacgaactggatgaagagccg
ggcggccaccatcattaccgccaaattgatccttcaaccgcacgaaaaaaaatagaaaag
ctggaccaattaatcgaccaagcccaggcatccgtgataaagcctgtataa

DBGET integrated database retrieval system