KEGG   Bacillus subtilis subsp. subtilis 168: BSU31840Help
Entry
BSU31840          CDS       T00010                                 

Gene name
yueD
Definition
(RefSeq) benzil reductase
  KO
K16216  benzil reductase ((S)-benzoin forming) [EC:1.1.1.320]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU31840 (yueD)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.320  benzil reductase [(S)-benzoin forming]
     BSU31840 (yueD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR NAD_binding_10 Epimerase RmlD_sub_bind NmrA
Motif
Other DBs
NCBI-GeneID: 936558
NCBI-ProteinID: NP_391062
Pasteur: BG13959
BSORF: BG13959
UniProt: O32099
Position
complement(3265406..3266137)
Genome map
AA seq 243 aa AA seqDB search
MELYIITGASKGLGQAIALQALEKGHEVHALSRTKTDVSHKKLTQHQIDLINLEEAEQQF
ETLLSSIDSDRYSGITLINNAGMVTPIKRAGEASLDELQRHYQLNLTAPVLLSQLFTKRF
ASYSGKKTVVNITSGAAKNPYKGWSAYCSSKAGLDMFTRTFGFEQEDEELPVNMISFSPG
VMDTEMQAVIRSSSKKDFHHIERFRKLNETGSLRSPDFIAGTLLSLLEKGTENGRIYDIK
EFL
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggaactttatatcatcaccggagcgtcaaaagggctgggtcaagccattgcattacag
gctttagaaaaggggcatgaagtccatgccttatccagaacgaaaacagatgtctctcac
aaaaaactaacgcagcatcaaatagacctcatcaatctcgaagaagctgaacagcaattt
gaaacattgctctcatccatcgattcagatcgttattctggtattacccttattaataac
gccggaatggtaacgccgatcaaacgtgccggcgaagcgtctcttgacgagcttcagcgc
cattatcagctgaacctgactgcgcccgtgcttttgagtcagctgtttacaaaacggttt
gcttcatacagcggcaaaaagacggttgtcaacattacttcaggagccgccaaaaatcca
tataagggatggagcgcgtattgcagttcaaaagccgggctcgacatgtttacgaggaca
ttcggatttgaacaggaggatgaagagctgccggtgaacatgatttcgttctcacctgga
gtgatggacactgagatgcaggccgtcatccgttcttcatcgaaaaaggatttccaccac
attgaacgattccggaaattaaatgaaacaggaagccttcgcagtccggactttattgcc
ggcacgctgctttctttactagaaaaagggacggaaaacggccgcatttatgatattaaa
gagtttttgtag

DBGET integrated database retrieval system