KEGG   Bacillus subtilis subsp. subtilis 168: BSU31850
Entry
BSU31850          CDS       T00010                                 

Gene name
yueC
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF5383 DUF5305 ABC2_membrane_3 DUF4064 TrbL
Other DBs
NCBI-GeneID: 936550
NCBI-ProteinID: NP_391063
Pasteur: BG13958
BSORF: BG13958
UniProt: O32100 A0A6M3ZIK9
Position
complement(3266200..3266655)
AA seq 151 aa
MLSFSLFIPSAAAAQTEENTDVAPNQYEKKDIEIDTNYLHEDTYYEEKTELPEEQKDITF
DKPKDKDAELIKDLFTSTNAEDSNTIAAQSKQLGITFAEKPMTKTSSTETEDEQETSSLL
LPMIYVVLILLGIAGIVFLIPKVTAQENKKA
NT seq 456 nt   +upstreamnt  +downstreamnt
atgctctccttttcccttttcataccctctgcagcggctgcccaaactgaagaaaataca
gatgtcgcgccaaaccagtatgagaaaaaagacatcgaaatcgatacgaattatttgcat
gaagatacctactatgaagaaaaaacagaactgcctgaggaacaaaaggatatcactttt
gataaaccgaaggacaaggacgccgagctgataaaagatttgtttacatcaacaaatgcc
gaggattccaacacgattgcggcccagtcgaaacagcttggaattacttttgctgaaaaa
ccaatgacaaagacatcatcaacggaaacagaagatgaacaagaaacatcatcattgctg
ctgccgatgatctatgtcgtactgatcctgctcggaattgcaggcatcgtgttcctcatc
ccaaaagtcacagcgcaggaaaacaagaaggcgtag

DBGET integrated database retrieval system