KEGG   Bacillus subtilis subsp. subtilis 168: BSU31860Help
Entry
BSU31860          CDS       T00010                                 

Gene name
yueB
Definition
(RefSeq) bacteriophage SPP1 adsorption protein YueB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2203 MapZ_C2 SlyX YtpI GARP
Motif
Other DBs
NCBI-GeneID: 936567
NCBI-ProteinID: NP_391064
Pasteur: BG13957
BSORF: BG13957
UniProt: O32101
Position
complement(3266687..3269917)
Genome map
AA seq 1076 aa AA seqDB search
MTEQRKSLIKLISAVIIILLLPVLFFRFIGDDPTKKAVNSTRQIAVVNEDTGVLSDEVKS
DEEDKSAQFGKEVAAVLGERPDYSWTVVNRSAAETGLASKKYDAIVYIPSDFSKNILSYD
KDHPQKATLEFSIQDNLNAVNKEKVQRELEDAQKTMNKKMSALYWNFVSQKVDNIRGEFD
KIVNKESEFQNVMYNFYKPSSNDLAGEIKQQKDLIDELKKSMNEAQGTTKEKASTAEEAK
NTLKEFIDTVERYKEYQENQKKLLLAAQDSTQQQIRTGLDAIQAQQKANQFSERMSGLAT
GIGQAKTQIGLTNLALNNAEKLRQNQVPLQEMGMKKIENDMFNAFLSRYKSQYEAIKYQN
LNQLQENIGKNRLSLLKPKESDEKEDGEDTSDNKDDTDKEDIEDIKLDLEKQRDELKNVA
TEIKDISEGLKEPEQEKPTTPDAEEPSTDDSPNTEEPSNDIPTSDDQPTNEDTGSSEEGT
QDNGSQNDVQTNIETGQKHQESSKNVPEQDTNTENTGTSKTDFSLIELADENDGSNQSDG
LQGDGADGETDISGAKKRLNEAAIKLEEIENALQEKQEEHNNKLEKHIDELNQEIKELNK
TVSKLNDQIGDLTKKLVDFDNNVNDAYRLIYNLEDEIIQTLQSRGYIDQKEKLSSIFSSR
IETDNISNLMKYYNSLNLYKSTLNDNLDLGSLTIIKGEVIQEQDGNVQSVLALTPEESAS
WEALKNNTMQTDEDINSFIDGMTKFADDYSGYIRDSQAGVLDELTKISESAAKASEQLVT
GATQESATFSNDGLSGTMALSVQDTVGQEVLQMSDMMGSLSDRQSGIIDYTTNMQQSVND
VQAKADTLNNNWGKNVASTKLVRNDVYGILGNTLVDGQNNGYVYDYLANPLKISGEVPEE
KIQTVPPVVILVIVLISSLLIGYFSSYYQNAPLLVKGALFGILNILVGLMISLFGLNIYS
LPDDQTIKWSVFTILLLVASSAFIRTAFRFGSIPGWVASAAMILFYVAPLIDLIMPNFTF
EDPVSKVYIDIQYGTGHLFTMGITVLLIITVIAVALPLIIRLMAEHTAESDETYEA
NT seq 3231 nt NT seq  +upstreamnt  +downstreamnt
atgacagaacaacgaaaaagcttgatcaagttaatatccgccgtcatcatcattttgctg
ctgccggtgttgtttttccgatttatcggagacgacccaacgaaaaaagcagtcaattct
acccggcaaatcgcggtggtgaatgaagacacaggcgtattgagtgatgaggtaaagtct
gatgaagaggacaaatccgcccagttcggcaaggaagtagcggccgttctgggtgaacgt
cctgattattcgtggacggtcgtaaaccgaagcgcggccgagaccggtctcgcttcaaag
aaatacgatgcgattgtctacattccctcagacttctcaaaaaacattttgagctatgac
aaagaccatcctcaaaaggcaacgctcgaattcagcattcaagataacctgaatgcggtt
aacaaagaaaaagttcagcgtgagcttgaggatgcccaaaagacaatgaacaaaaaaatg
tcggccttatactggaattttgtttcgcaaaaagtggacaacatcagaggagaatttgac
aagatcgtcaataaagaatctgaattccagaatgtcatgtacaacttttacaaaccaagc
tctaatgatttagcaggtgaaatcaaacagcaaaaagacttaatcgatgagctgaagaaa
tcaatgaatgaagcgcaaggcacgacaaaagaaaaagcttctacggcggaggaagccaaa
aacacgctgaaagaattcattgatacagttgaaaggtacaaagaatatcaagagaatcag
aaaaagctgcttttggcagcccaggattcaacacagcagcaaatccggacaggtctggat
gccatccaggcacagcaaaaggcgaatcagttcagcgaacgcatgagcggattggcaacc
gggatcggccaagcgaagacacaaataggactgacaaaccttgcgttgaacaatgctgaa
aagttaaggcaaaatcaagtgccattgcaagaaatgggtatgaaaaaaattgagaatgac
atgtttaatgcatttctatctcgatataaaagtcaatatgaagctattaaatatcaaaat
ttaaatcaattgcaagagaatatcgggaagaaccgccttagtttacttaaacctaaggaa
agcgacgaaaaggaagatggagaagacacatctgataataaagatgacacagataaggaa
gatattgaagatataaaattggatttagagaagcagcgggatgagctcaaaaatgttgca
actgaaattaaagatatctctgaagggttaaaagaacctgaacaagaaaaaccaacaaca
cccgatgctgaagaaccatcaaccgatgattctcctaatactgaagaaccgtcgaatgat
attccaacatccgatgatcagccaacaaatgaagatactggctcatcagaagagggtact
caagataatggatcacaaaatgatgttcaaactaacattgaaacgggacaaaaacatcaa
gaatcttcaaaaaacgttcctgaacaagatacaaacacggagaatacaggaacctctaaa
acagatttctctttgattgaactcgcagatgaaaacgatggctcaaatcaaagtgatggg
ctacagggtgacggagctgacggtgaaactgatatttcaggtgcaaaaaaacgtctgaac
gaagcagcgataaaattagaggaaatagaaaatgcacttcaagaaaaacaagaggaacat
aacaacaaactagagaaacatattgatgagttaaatcaagaaattaaagagttaaataaa
acagtttcaaaattaaatgatcaaattggtgacttaacaaaaaagttggttgattttgat
aataatgtcaatgatgcttataggttaatatacaatttggaagacgaaataatacaaact
ttgcagagtagaggctatatagatcagaaagaaaaactaagttcaattttttcaagtaga
attgaaactgataatatttctaacttgatgaagtattacaactctttaaatttatataag
tctacgctaaatgataatctggatctaggctctttgactattattaaaggtgaagtcatc
caagagcaagatggcaacgtccaatcagtcctggctctcacacctgaagaatcagccagc
tgggaagctctcaaaaacaacacgatgcaaacagatgaggatattaacagcttcatcgac
ggcatgaccaaatttgcggacgactacagcggctatatccgtgactctcaagcaggtgtt
ctcgacgaactgacgaaaatctctgaaagtgccgcaaaagcgtcagaacagcttgtaacg
ggcgcaacacaggaatctgcgacgttcagcaacgatgggctgtctggtaccatggcactg
agtgtccaagatacggtcggccaggaagtgctgcaaatgtcagacatgatgggttcattg
tctgatcgccagtccggcatcattgattacacaaccaacatgcagcaaagcgttaatgat
gttcaagcgaaagccgacaccttaaacaacaactgggggaaaaatgtcgcctccacgaaa
ctcgtgcgaaatgacgtatacggcatactcggaaatacattagtagacgggcaaaacaat
ggctatgtatatgattacttagcgaatccgcttaaaatcagcggagaggttccggaagaa
aaaattcagacggtacctccggttgtcatccttgtcattgtgttgatcagcagtctgtta
atcggctatttcagctcgtattaccaaaacgcaccgcttctcgtcaaaggagcgttattc
ggaattctgaatatccttgtcggacttatgatcagcttgttcggcttgaatatttattca
ctgccggacgatcagacgattaagtggtcggtgtttacgattctattgctggtcgcaagc
tctgccttcatccggacggcattcagattcggatcaatccctggctgggttgcttcagca
gcaatgatcctattctatgtcgcaccgcttattgatttgatcatgccgaactttacattt
gaagatccggtttcgaaagtatatatcgacatccagtacggtactgggcacttgtttaca
atgggaataacagttctgctgatcattacggtgattgccgtggctctgccgctgattatc
cggttgatggctgaacacacagcagaaagcgatgaaacgtatgaagcgtga

DBGET integrated database retrieval system