KEGG   Bacillus subtilis subsp. subtilis 168: BSU31890Help
Entry
BSU31890          CDS       T00010                                 

Gene name
yukC
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YukC PPP4R2 Borrelia_P83 GAGA_bind DUF4228
Motif
Other DBs
NCBI-GeneID: 936572
NCBI-ProteinID: NP_391067
Pasteur: BG12376
BSORF: BG12376
UniProt: P71070
Position
complement(3274462..3275817)
Genome map
AA seq 451 aa AA seqDB search
MSGEQKSYLENQLEAVAEKTDAGYTFTFQREKIKLLDGLEANVIKDINPFFHKEIDVTDD
EVIITIQPPSSYKAFRFMKAKDKKSKWQFAYQLVQAVQQHNLSRLNLIVAPENIVFDKGL
TPYFLHYGVKESIPPYERDEERVWQELKAAAALAVDGAFAFEDYLKFNETLTFSAEAKAI
LDAESYDDLLELIQTHIDELEAKAKTYIHIPRKKWNIQRYIGLGLIVLLVPALIYSMYAL
FFAQPKHQAIVDSNRAFLNKQYSEVISTLSKYDAESLPESVQYQLATSYVEVENLGSAKT
KNIENNLVTLQSDPQHFLYWIDYGRGEYKEAISIGRKLEYNDYIYFALAKYKQQLLSEDT
NDEDIQKELDSVNSELEKAQKERQENKQSNSETSLVDTSEEQTQTDEEKQAEEKAAEEKA
AAEEKAKKEEQKEKEDEKKETEKKDEKKDDK
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggtgaacaaaaatcatatttagaaaaccaattagaagctgttgccgagaaaaca
gatgccggctatacatttacctttcaacgggaaaaaataaagcttctcgacggtcttgaa
gctaacgtgatcaaagatataaatccattttttcataaagaaatcgatgtgacggatgat
gaagtaatcatcacaatccaacctccctcctcctataaagcattccgcttcatgaaagct
aaggataaaaaaagtaaatggcagtttgcctatcagcttgttcaagccgtacagcagcac
aatctgtcgaggctgaatttgattgtcgctcctgaaaacattgtattcgataaagggctt
acgccttattttctccattatggagtaaaagaaagcattcctccttacgagcgtgatgag
gaaagagtatggcaggagctgaaagcggcagcggctttggcagttgacggcgcttttgcg
tttgaagactacctgaaattcaatgaaacgctgacgttctccgcagaggcaaaggcgata
ttagatgctgaatcctatgatgatttgctcgagctgattcaaacccatattgatgagctc
gaagccaaagcaaaaacatacatacatatcccgagaaagaagtggaacatccagcgatat
atcggcctggggctcattgttttgcttgtaccggcacttatttattcgatgtacgcctta
tttttcgcgcagccaaagcaccaggcgatagtggacagcaaccgtgcgttcttaaacaag
cagtacagtgaagtcatcagcacactgtccaagtacgatgcggaaagcctgcctgaatcg
gtgcagtatcagctggcgacgtcctatgttgaggtcgaaaacctggggagtgcaaaaacc
aaaaatatagaaaataatttagtcacccttcaatcagaccctcagcatttcttatattgg
attgattatggtcgaggagaatacaaagaagcgatcagtatcggccgtaagctggaatac
aatgattatatttactttgccctagctaaatataaacagcagcttttatctgaggataca
aatgatgaagacatacaaaaagaacttgattcagtaaatagtgagcttgaaaaagcccaa
aaagaacgtcaagaaaataaacagtctaattctgaaacatcgttagtcgatacaagcgaa
gaacagacacaaacagacgaagaaaaacaagcagaagagaaagcggcagaagaaaaagcc
gcagccgaggaaaaagcgaaaaaagaagaacagaaggaaaaagaagacgagaaaaaagaa
acagaaaagaaagatgagaaaaaagatgacaaataa

DBGET integrated database retrieval system