KEGG   Bacillus subtilis subsp. subtilis 168: BSU31900
Entry
BSU31900          CDS       T00010                                 

Symbol
yukD
Name
(RefSeq) ubiquitin-like protein YukD
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YukD Rad60-SLD_2 TmoB
Other DBs
NCBI-GeneID: 936543
NCBI-ProteinID: NP_391068
Pasteur: BG12377
BSORF: BG12377
UniProt: P71071 A0A6M4JLR8
Structure
PDB: 
2BPS

Position
complement(3275832..3276071)
AA seq 79 aa
MYIDITIDLKHYNGSVFDLRLSDYHPVKKVIDIAWQAQSVSMPPREGHWIRVVNKDKVFS
GECKLSDCGITNGDRLEIL
NT seq 240 nt   +upstreamnt  +downstreamnt
atgtatattgatattacaatagatttgaaacattataacggcagtgtctttgatctcaga
ttgtcagattaccacccggtgaaaaaagtaattgatattgcttggcaggcccaaagcgta
tctatgcctccgcgcgaagggcactggatcagagtggtgaacaaggataaggtgttttcc
ggagaatgcaagctgtctgattgcggcattacaaacggagaccggcttgaaatattatga

DBGET integrated database retrieval system