KEGG   Bacillus subtilis subsp. subtilis 168: BSU31900Help
Entry
BSU31900          CDS       T00010                                 

Gene name
yukD
Definition
(RefSeq) ubiquitin-like protein YukD
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YukD TmoB Rad60-SLD_2
Motif
Other DBs
NCBI-GeneID: 936543
NCBI-ProteinID: NP_391068
Pasteur: BG12377
BSORF: BG12377
UniProt: P71071
Structure
PDB: 

Position
complement(3275832..3276071)
Genome map
AA seq 79 aa AA seqDB search
MYIDITIDLKHYNGSVFDLRLSDYHPVKKVIDIAWQAQSVSMPPREGHWIRVVNKDKVFS
GECKLSDCGITNGDRLEIL
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atgtatattgatattacaatagatttgaaacattataacggcagtgtctttgatctcaga
ttgtcagattaccacccggtgaaaaaagtaattgatattgcttggcaggcccaaagcgta
tctatgcctccgcgcgaagggcactggatcagagtggtgaacaaggataaggtgttttcc
ggagaatgcaagctgtctgattgcggcattacaaacggagaccggcttgaaatattatga

DBGET integrated database retrieval system