KEGG   Bacillus subtilis subsp. subtilis 168: BSU31920Help
Entry
BSU31920          CDS       T00010                                 

Gene name
yukF
Definition
(RefSeq) transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_30 GGDEF_2 CodY HTH_8
Motif
Other DBs
NCBI-GeneID: 938860
NCBI-ProteinID: NP_391070
Pasteur: BG12379
BSORF: BG12379
UniProt: P71073
Position
3276955..3278223
Genome map
AA seq 422 aa AA seqDB search
MSKRNQARKVGRFMTMPNDPFKYSFDRLEDVADHISDVLRCPITIEDVNHKLLAYSTHSD
CTDPARTSTIIGRRVPEKVINKLWKDGTIPALLKTDQPIRVKQIDEVGLSNRVAISIWKN
KQVLGFIWALEIQKTLSDEDLLTLQMAAKAVKNKLLKLQIRKTKNEERSQEFFWKMLTGH
IHQEDDMADGFHKLGMAAPSEFSVMIIRINGELTEKIEQQLQYLQETTQQVYVLLATVDS
NELIILTSPKTDHPFQDLKQFALSTQKQLKERYKIEDVSIAFGGIYNSISFVSRSYQEAL
SVLKTKERFAEETKHLFSFSELGIYQYLDVLNEKRKQAGHYNYSLSKLEQYDRDHQSNMV
ETLERFIEADSNVNTASKLLNIHVNTLNYRLKRISQIAEIDLKNVNQKFTIYLDIKLRHM
DL
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagagaaatcaagcacgaaaagtagggagatttatgaccatgccgaatgatccg
tttaaatatagttttgacagacttgaagatgtggctgatcatatcagcgacgttctgcgg
tgcccgatcaccatagaggatgttaaccacaagctgcttgcctacagtacacacagcgac
tgcacagaccctgcccggacgtctaccattattggcagaagggtaccggagaaggtgatt
aacaagctgtggaaagacgggacaattcctgctctcttaaaaacggaccagccgatcaga
gtcaagcaaatcgatgaagtcgggctgagcaatcgcgtcgctatttcgatttggaaaaac
aagcaagtacttggcttcatatgggcgcttgagatccaaaaaacattgtccgatgaagat
ctgctgacattgcaaatggcagcaaaagcagtgaaaaacaagcttctcaaacttcaaatc
agaaaaacgaaaaatgaagaacgcagccaagaatttttctggaaaatgctgaccggacac
atccatcaggaggatgatatggcggatgggttccataagcttggaatggccgctccttca
gagttttccgttatgatcatccgcataaatggcgagctgactgaaaaaatcgaacagcag
ctgcaatatttacaggaaacgacccagcaggtttacgtgctgctggcgaccgtagattcc
aatgaacttattatattaacctcacccaaaacagatcatccttttcaagatttaaaacag
tttgctttaagtacgcaaaaacagctgaaggagcggtataaaatagaagacgtttctatc
gcttttggcggaatatacaactctatttcttttgtctcccgctcctatcaggaagcattg
tccgtcttaaaaacgaaggaacggttcgctgaagagaccaaacatcttttcagcttttct
gagttaggcatttatcaatacttagatgtcttaaatgaaaaacggaaacaggcgggccat
tataattactcgctttccaaactggaacaatatgaccgggatcaccagtcaaatatggta
gagacgctagagcgctttattgaagcggacagcaacgtgaataccgcttccaagctgtta
aatatacacgttaatacgttgaattaccgactcaagcggatcagccagatcgctgaaatt
gatttgaaaaatgtgaatcaaaaattcaccatctatttagatatcaaacttcggcacatg
gatttgtga

DBGET integrated database retrieval system