KEGG   Bacillus subtilis subsp. subtilis 168: BSU31930Help
Entry
BSU31930          CDS       T00010                                 

Gene name
ald
Definition
(RefSeq) alanine dehydrogenase
  KO
K00259  alanine dehydrogenase [EC:1.4.1.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00250  Alanine, aspartate and glutamate metabolism
bsu00430  Taurine and hypotaurine metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BSU31930 (ald)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    BSU31930 (ald)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.1  alanine dehydrogenase
     BSU31930 (ald)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AlaDh_PNT_C AlaDh_PNT_N 2-Hacid_dh_C Shikimate_DH Pyr_redox F420_oxidored Pyr_redox_2 NAD_binding_2 3HCDH_N TrkA_N NAD_binding_7 GIDA UDPG_MGDP_dh_N IlvN ADH_zinc_N NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-GeneID: 936557
NCBI-ProteinID: NP_391071
Pasteur: BG10468
BSORF: BG10468
UniProt: Q08352
Position
3278325..3279461
Genome map
AA seq 378 aa AA seqDB search
MIIGVPKEIKNNENRVALTPGGVSQLISNGHRVLVETGAGLGSGFENEAYESAGAEIIAD
PKQVWDAEMVMKVKEPLPEEYVYFRKGLVLFTYLHLAAEPELAQALKDKGVTAIAYETVS
EGRTLPLLTPMSEVAGRMAAQIGAQFLEKPKGGKGILLAGVPGVSRGKVTIIGGGVVGTN
AAKMAVGLGADVTIIDLNADRLRQLDDIFGHQIKTLISNPVNIADAVAEADLLICAVLIP
GAKAPTLVTEEMVKQMKPGSVIVDVAIDQGGIVETVDHITTHDQPTYEKHGVVHYAVANM
PGAVPRTSTIALTNVTVPYALQIANKGAVKALADNTALRAGLNTANGHVTYEAVARDLGY
EYVPAEKALQDESSVAGA
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgatcataggggttcctaaagagataaaaaacaatgaaaaccgtgtcgcattaacaccc
gggggcgtttctcagctcatttcaaacggccaccgggtgctggttgaaacaggcgcgggc
cttggaagcggatttgaaaatgaagcctatgagtcagcaggagcggaaatcattgctgat
ccgaagcaggtctgggacgccgaaatggtcatgaaagtaaaagaaccgctgccggaagaa
tatgtttattttcgcaaaggacttgtgctgtttacgtaccttcatttagcagctgagcct
gagcttgcacaggccttgaaggataaaggagtaactgccatcgcatatgaaacggtcagt
gaaggccggacattgcctcttctgacgccaatgtcagaggttgcgggcagaatggcagcg
caaatcggcgctcaattcttagaaaagcctaaaggcggaaaaggcattctgcttgccggg
gtgcctggcgtttcccgcggaaaagtaacaattatcggaggaggcgttgtcgggacaaac
gcggcgaaaatggctgtcggcctcggtgcagatgtgacgatcattgacttaaacgcagac
cgcttgcgccagcttgatgacatcttcggccatcagattaaaacgttaatttctaatccg
gtcaatattgctgatgctgtggcggaagcggatctcctcatttgcgcggtattaattccg
ggtgctaaagctccgactcttgtcactgaggaaatggtaaaacaaatgaaacccggttca
gttattgttgatgtagcgatcgaccaaggcggcatcgtcgaaactgtcgaccatatcaca
acacatgatcagccaacatatgaaaaacacggggttgtgcattatgctgtagcgaacatg
ccaggcgcagtccctcgtacatcaacaatcgccctgactaacgttactgttccatacgcg
ctgcaaatcgcgaacaaaggggcagtaaaagcgctcgcagacaatacggcactgagagcg
ggtttaaacaccgcaaacggacacgtgacctatgaagctgtagcaagagatctaggctat
gagtatgttcctgccgagaaagctttacaggatgaatcatctgtggcgggtgcttaa

DBGET integrated database retrieval system