KEGG   Bacillus subtilis subsp. subtilis 168: BSU31945
Entry
BSU31945          CDS       T00010                                 

Gene name
yukJ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2278 DUF4597
Other DBs
NCBI-GeneID: 937111
NCBI-ProteinID: NP_391073
UniProt: C0SPB1 A0A6M4JMJ1
Position
3279573..3280250
AA seq 225 aa
MAVQQYGVLKGIVLDMKRETDDDSPHFQVKMLGEENTYYRCAINVMSSSEESEVLYLADD
QFDSGSITILPNMPYGYTRINEANREVALDYVRGNLFDPREMKPLPHEITGPDNDLNDFI
ETYMKKAQDEKTPVYIFGSKFGPEQAADKIFGFTPTNGMHNIHMNQGNAMDTRWKKDNGS
WHDGGILIQFADQWAAVFLAFLSQSWCTDENGNPVRDCDHTQTSA
NT seq 678 nt   +upstreamnt  +downstreamnt
atggctgttcagcaatatggcgtgttaaaaggcatagtattagacatgaagcgggaaaca
gatgatgacagtcctcatttccaagtcaaaatgctcggtgaagagaatacgtattacagg
tgcgccatcaatgtgatgtccagttctgaggaatctgaagtattgtatttggctgacgat
cagtttgattcgggctcaattaccatccttccgaacatgccgtatggatatacaaggatc
aatgaagcaaaccgtgaagtggcactggattatgtgcggggcaatttgtttgacccgcgg
gaaatgaagcctttgcctcatgaaatcacgggacctgataatgatttaaatgattttatt
gaaacctatatgaagaaagcacaagatgagaaaacgccggtttatatattcggttcaaaa
ttcggccctgaacaggctgcagataaaatattcggctttaccccgactaacggaatgcac
aatatccatatgaatcaagggaatgcaatggatacccgctggaaaaaagacaacggctct
tggcatgacgggggtattctgattcagtttgcagatcagtgggccgctgtgtttttagcg
tttttatcccaatcttggtgtaccgatgaaaacggaaaccctgtcagagattgtgatcat
acccaaacgtctgcgtaa

DBGET integrated database retrieval system